SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|225857368|ref|YP_002738879.1| from Streptococcus pneumoniae P1031

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225857368|ref|YP_002738879.1|
Domain Number 1 Region: 3-102
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.28e-33
Family Thioltransferase 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|225857368|ref|YP_002738879.1|
Sequence length 104
Comment thioredoxin [Streptococcus pneumoniae P1031]
Sequence
MAKAITDATFEQETKDGLVLVDFWATWCGPCRMQGPILDKLSEELSEDVLKIVKMDVDEN
PNTARAFGIMSIPTLLFKKDGQVVKQVAGVHTAEQIKAIIAELS
Download sequence
Identical sequences A0A0B7LQ67 A0A0H2URA9 A0A0T9FNH2 A0A158LIW0 A0A1L8Q620 A5LQN0 A5M620 B1I7N7 B2ISD1 C1C915 C1CFZ6 D6ZMY9 G6JCR4 G6LPN9 J1NU81 M5JV96 M5KI66 M5N6L4
gi|225857368|ref|YP_002738879.1| gi|480531751|ref|YP_007763955.1| gi|225855205|ref|YP_002736717.1| gi|387626962|ref|YP_006063138.1| gi|480537194|ref|YP_007815103.1| gi|387788799|ref|YP_006253867.1| WP_001029580.1.1 WP_001029580.1.10 WP_001029580.1.100001 WP_001029580.1.100011 WP_001029580.1.100012 WP_001029580.1.100026 WP_001029580.1.100033 WP_001029580.1.100039 WP_001029580.1.100048 WP_001029580.1.100054 WP_001029580.1.10009 WP_001029580.1.100102 WP_001029580.1.100109 WP_001029580.1.100110 WP_001029580.1.100114 WP_001029580.1.100140 WP_001029580.1.100153 WP_001029580.1.100158 WP_001029580.1.100164 WP_001029580.1.100168 WP_001029580.1.100169 WP_001029580.1.100186 WP_001029580.1.100197 WP_001029580.1.10020 WP_001029580.1.100201 WP_001029580.1.100203 WP_001029580.1.100240 WP_001029580.1.100263 WP_001029580.1.100289 WP_001029580.1.100325 WP_001029580.1.100333 WP_001029580.1.100339 WP_001029580.1.10035 WP_001029580.1.100353 WP_001029580.1.100364 WP_001029580.1.100369 WP_001029580.1.100397 WP_001029580.1.100477 WP_001029580.1.100492 WP_001029580.1.100516 WP_001029580.1.100525 WP_001029580.1.100532 WP_001029580.1.100540 WP_001029580.1.100572 WP_001029580.1.100579 WP_001029580.1.1006 WP_001029580.1.10060 WP_001029580.1.100627 WP_001029580.1.100629 WP_001029580.1.100634 WP_001029580.1.100679 WP_001029580.1.100681 WP_001029580.1.100715 WP_001029580.1.100734 WP_001029580.1.100745 WP_001029580.1.100805 WP_001029580.1.100816 WP_001029580.1.100818 WP_001029580.1.100829 WP_001029580.1.100839 WP_001029580.1.100848 WP_001029580.1.100855 WP_001029580.1.100863 WP_001029580.1.100874 WP_001029580.1.100892 WP_001029580.1.100897 WP_001029580.1.100911 WP_001029580.1.100914 WP_001029580.1.100937 WP_001029580.1.100940 WP_001029580.1.100947 WP_001029580.1.100997 WP_001029580.1.10103 WP_001029580.1.101044 WP_001029580.1.101045 WP_001029580.1.101061 WP_001029580.1.101062 WP_001029580.1.101066 WP_001029580.1.101080 WP_001029580.1.101092 WP_001029580.1.101098 WP_001029580.1.101116 WP_001029580.1.101127 WP_001029580.1.101135 WP_001029580.1.101167 WP_001029580.1.101176 WP_001029580.1.101178 WP_001029580.1.10118 WP_001029580.1.101181 WP_001029580.1.101201 WP_001029580.1.101205 WP_001029580.1.101213 WP_001029580.1.101215 WP_001029580.1.101219 WP_001029580.1.10122 WP_001029580.1.10123 WP_001029580.1.101232 WP_001029580.1.101241 WP_001029580.1.101250 WP_001029580.1.101256 WP_001029580.1.101274 WP_001029580.1.101286 WP_001029580.1.101287 WP_001029580.1.101315 WP_001029580.1.101373 WP_001029580.1.101394 WP_001029580.1.101407 WP_001029580.1.101410 WP_001029580.1.101435 WP_001029580.1.101438 WP_001029580.1.101457 WP_001029580.1.101464 WP_001029580.1.101482 WP_001029580.1.101483 WP_001029580.1.101484 WP_001029580.1.101489 WP_001029580.1.101494 WP_001029580.1.101497 WP_001029580.1.101500 WP_001029580.1.101517 WP_001029580.1.10153 WP_001029580.1.101560 WP_001029580.1.101577 WP_001029580.1.101595 WP_001029580.1.101599 WP_001029580.1.101614 WP_001029580.1.101649 WP_001029580.1.101685 WP_001029580.1.101689 WP_001029580.1.10169 WP_001029580.1.1017 WP_001029580.1.101709 WP_001029580.1.101738 WP_001029580.1.101746 WP_001029580.1.10175 WP_001029580.1.101750 WP_001029580.1.101760 WP_001029580.1.101763 WP_001029580.1.101765 WP_001029580.1.101784 WP_001029580.1.101789 WP_001029580.1.101790 WP_001029580.1.101801 WP_001029580.1.101803 WP_001029580.1.101806 WP_001029580.1.10183 WP_001029580.1.101842 WP_001029580.1.101847 WP_001029580.1.101857 WP_001029580.1.101875 WP_001029580.1.101876 WP_001029580.1.101895 WP_001029580.1.101912 WP_001029580.1.10192 WP_001029580.1.101946 WP_001029580.1.10196 WP_001029580.1.101961 WP_001029580.1.101974 WP_001029580.1.101988 WP_001029580.1.1020 WP_001029580.1.102004 WP_001029580.1.102006 WP_001029580.1.102077 WP_001029580.1.102086 WP_001029580.1.102091 WP_001029580.1.102115 WP_001029580.1.102129 WP_001029580.1.102134 WP_001029580.1.102141 WP_001029580.1.10221 WP_001029580.1.1026 WP_001029580.1.10261 WP_001029580.1.10284 WP_001029580.1.10295 WP_001029580.1.10314 WP_001029580.1.10316 WP_001029580.1.10337 WP_001029580.1.1034 WP_001029580.1.10364 WP_001029580.1.10367 WP_001029580.1.10426 WP_001029580.1.10458 WP_001029580.1.10494 WP_001029580.1.10500 WP_001029580.1.10504 WP_001029580.1.10515 WP_001029580.1.10571 WP_001029580.1.10574 WP_001029580.1.1059 WP_001029580.1.10591 WP_001029580.1.10599 WP_001029580.1.10613 WP_001029580.1.10619 WP_001029580.1.10622 WP_001029580.1.10683 WP_001029580.1.1069 WP_001029580.1.10692 WP_001029580.1.1070 WP_001029580.1.10708 WP_001029580.1.10713 WP_001029580.1.10731 WP_001029580.1.1076 WP_001029580.1.10760 WP_001029580.1.10766 WP_001029580.1.10789 WP_001029580.1.10807 WP_001029580.1.10812 WP_001029580.1.10819 WP_001029580.1.10820 WP_001029580.1.10827 WP_001029580.1.10828 WP_001029580.1.1083 WP_001029580.1.10900 WP_001029580.1.1091 WP_001029580.1.10910 WP_001029580.1.10914 WP_001029580.1.10932 WP_001029580.1.10933 WP_001029580.1.10934 WP_001029580.1.10937 WP_001029580.1.10948 WP_001029580.1.10951 WP_001029580.1.10952 WP_001029580.1.10987 WP_001029580.1.11 WP_001029580.1.11007 WP_001029580.1.11027 WP_001029580.1.11035 WP_001029580.1.11043 WP_001029580.1.11045 WP_001029580.1.11079 WP_001029580.1.11085 WP_001029580.1.11093 WP_001029580.1.11096 WP_001029580.1.11099 WP_001029580.1.11102 WP_001029580.1.11103 WP_001029580.1.11131 WP_001029580.1.11139 WP_001029580.1.11144 WP_001029580.1.11151 WP_001029580.1.11154 WP_001029580.1.11197 WP_001029580.1.11205 WP_001029580.1.11233 WP_001029580.1.11243 WP_001029580.1.11260 WP_001029580.1.11279 WP_001029580.1.11289 WP_001029580.1.11297 WP_001029580.1.11298 WP_001029580.1.11299 WP_001029580.1.1131 WP_001029580.1.11311 WP_001029580.1.11319 WP_001029580.1.11328 WP_001029580.1.11337 WP_001029580.1.11383 WP_001029580.1.11409 WP_001029580.1.11413 WP_001029580.1.11425 WP_001029580.1.11428 WP_001029580.1.11435 WP_001029580.1.11439 WP_001029580.1.11448 WP_001029580.1.11474 WP_001029580.1.11486 WP_001029580.1.11495 WP_001029580.1.11509 WP_001029580.1.11510 WP_001029580.1.11537 WP_001029580.1.11546 WP_001029580.1.11563 WP_001029580.1.11570 WP_001029580.1.11573 WP_001029580.1.11594 WP_001029580.1.11617 WP_001029580.1.11619 WP_001029580.1.11622 WP_001029580.1.11624 WP_001029580.1.1165 WP_001029580.1.11652 WP_001029580.1.11657 WP_001029580.1.11669 WP_001029580.1.11682 WP_001029580.1.11706 WP_001029580.1.11711 WP_001029580.1.11760 WP_001029580.1.11765 WP_001029580.1.1178 WP_001029580.1.11792 WP_001029580.1.11811 WP_001029580.1.11823 WP_001029580.1.11842 WP_001029580.1.11858 WP_001029580.1.11861 WP_001029580.1.11871 WP_001029580.1.11902 WP_001029580.1.1192 WP_001029580.1.11922 WP_001029580.1.11931 WP_001029580.1.11935 WP_001029580.1.11950 WP_001029580.1.11967 WP_001029580.1.1201 WP_001029580.1.12023 WP_001029580.1.12024 WP_001029580.1.12034 WP_001029580.1.12044 WP_001029580.1.12046 WP_001029580.1.12062 WP_001029580.1.12068 WP_001029580.1.12084 WP_001029580.1.12085 WP_001029580.1.12099 WP_001029580.1.12113 WP_001029580.1.12125 WP_001029580.1.12128 WP_001029580.1.12131 WP_001029580.1.12134 WP_001029580.1.12140 WP_001029580.1.12154 WP_001029580.1.12182 WP_001029580.1.12186 WP_001029580.1.12198 WP_001029580.1.1221 WP_001029580.1.12218 WP_001029580.1.12222 WP_001029580.1.12238 WP_001029580.1.12243 WP_001029580.1.12273 WP_001029580.1.1230 WP_001029580.1.12306 WP_001029580.1.12307 WP_001029580.1.12312 WP_001029580.1.1233 WP_001029580.1.12336 WP_001029580.1.12337 WP_001029580.1.12339 WP_001029580.1.12383 WP_001029580.1.12395 WP_001029580.1.12404 WP_001029580.1.12407 WP_001029580.1.12413 WP_001029580.1.12427 WP_001029580.1.12428 WP_001029580.1.12429 WP_001029580.1.1243 WP_001029580.1.12430 WP_001029580.1.12434 WP_001029580.1.12440 WP_001029580.1.12443 WP_001029580.1.12444 WP_001029580.1.12450 WP_001029580.1.12470 WP_001029580.1.12487 WP_001029580.1.12489 WP_001029580.1.12492 WP_001029580.1.12494 WP_001029580.1.12524 WP_001029580.1.12538 WP_001029580.1.12543 WP_001029580.1.12570 WP_001029580.1.12578 WP_001029580.1.1258 WP_001029580.1.12580 WP_001029580.1.12583 WP_001029580.1.12587 WP_001029580.1.12588 WP_001029580.1.12595 WP_001029580.1.12613 WP_001029580.1.1262 WP_001029580.1.12651 WP_001029580.1.12673 WP_001029580.1.12677 WP_001029580.1.12681 WP_001029580.1.12723 WP_001029580.1.12729 WP_001029580.1.12754 WP_001029580.1.12757 WP_001029580.1.12765 WP_001029580.1.12777 WP_001029580.1.12786 WP_001029580.1.128 WP_001029580.1.12805 WP_001029580.1.12811 WP_001029580.1.12813 WP_001029580.1.1282 WP_001029580.1.12866 WP_001029580.1.1288 WP_001029580.1.12898 WP_001029580.1.12905 WP_001029580.1.12928 WP_001029580.1.12942 WP_001029580.1.12948 WP_001029580.1.12952 WP_001029580.1.12958 WP_001029580.1.12963 WP_001029580.1.12966 WP_001029580.1.12985 WP_001029580.1.12996 WP_001029580.1.13000 WP_001029580.1.1302 WP_001029580.1.13023 WP_001029580.1.1303 WP_001029580.1.13033 WP_001029580.1.13035 WP_001029580.1.13036 WP_001029580.1.13048 WP_001029580.1.13058 WP_001029580.1.13065 WP_001029580.1.13067 WP_001029580.1.13099 WP_001029580.1.13100 WP_001029580.1.13119 WP_001029580.1.13123 WP_001029580.1.13140 WP_001029580.1.13168 WP_001029580.1.13187 WP_001029580.1.13209 WP_001029580.1.13229 WP_001029580.1.13245 WP_001029580.1.13256 WP_001029580.1.1328 WP_001029580.1.13286 WP_001029580.1.1330 WP_001029580.1.13305 WP_001029580.1.13310 WP_001029580.1.1332 WP_001029580.1.13324 WP_001029580.1.13328 WP_001029580.1.13330 WP_001029580.1.13331 WP_001029580.1.13340 WP_001029580.1.13351 WP_001029580.1.13382 WP_001029580.1.13390 WP_001029580.1.13402 WP_001029580.1.13410 WP_001029580.1.13455 WP_001029580.1.1348 WP_001029580.1.135 WP_001029580.1.13515 WP_001029580.1.13527 WP_001029580.1.13537 WP_001029580.1.13560 WP_001029580.1.13565 WP_001029580.1.13581 WP_001029580.1.13584 WP_001029580.1.13590 WP_001029580.1.13604 WP_001029580.1.13606 WP_001029580.1.13629 WP_001029580.1.13643 WP_001029580.1.1367 WP_001029580.1.1368 WP_001029580.1.13682 WP_001029580.1.13692 WP_001029580.1.13701 WP_001029580.1.13705 WP_001029580.1.13710 WP_001029580.1.13729 WP_001029580.1.13738 WP_001029580.1.13745 WP_001029580.1.13830 WP_001029580.1.13839 WP_001029580.1.13845 WP_001029580.1.13854 WP_001029580.1.13873 WP_001029580.1.13886 WP_001029580.1.139 WP_001029580.1.1391 WP_001029580.1.13917 WP_001029580.1.13954 WP_001029580.1.13958 WP_001029580.1.13960 WP_001029580.1.13989 WP_001029580.1.1399 WP_001029580.1.13990 WP_001029580.1.13997 WP_001029580.1.13998 WP_001029580.1.13999 WP_001029580.1.14002 WP_001029580.1.14012 WP_001029580.1.14033 WP_001029580.1.14051 WP_001029580.1.14066 WP_001029580.1.14077 WP_001029580.1.14082 WP_001029580.1.14107 WP_001029580.1.14126 WP_001029580.1.14131 WP_001029580.1.14132 WP_001029580.1.14166 WP_001029580.1.14183 WP_001029580.1.14211 WP_001029580.1.14217 WP_001029580.1.14218 WP_001029580.1.14254 WP_001029580.1.14258 WP_001029580.1.14260 WP_001029580.1.14287 WP_001029580.1.14291 WP_001029580.1.14294 WP_001029580.1.14295 WP_001029580.1.1432 WP_001029580.1.14335 WP_001029580.1.14347 WP_001029580.1.14374 WP_001029580.1.14384 WP_001029580.1.14404 WP_001029580.1.14408 WP_001029580.1.14409 WP_001029580.1.14422 WP_001029580.1.14430 WP_001029580.1.14435 WP_001029580.1.14440 WP_001029580.1.14480 WP_001029580.1.1449 WP_001029580.1.145 WP_001029580.1.14511 WP_001029580.1.14513 WP_001029580.1.14534 WP_001029580.1.14541 WP_001029580.1.14558 WP_001029580.1.14560 WP_001029580.1.14578 WP_001029580.1.14599 WP_001029580.1.14622 WP_001029580.1.14657 WP_001029580.1.14662 WP_001029580.1.14663 WP_001029580.1.14682 WP_001029580.1.14740 WP_001029580.1.14745 WP_001029580.1.14757 WP_001029580.1.14779 WP_001029580.1.14784 WP_001029580.1.14826 WP_001029580.1.14831 WP_001029580.1.14880 WP_001029580.1.14885 WP_001029580.1.14889 WP_001029580.1.14892 WP_001029580.1.14899 WP_001029580.1.14900 WP_001029580.1.14949 WP_001029580.1.14957 WP_001029580.1.14959 WP_001029580.1.14975 WP_001029580.1.14983 WP_001029580.1.1502 WP_001029580.1.15024 WP_001029580.1.15026 WP_001029580.1.1503 WP_001029580.1.15030 WP_001029580.1.15045 WP_001029580.1.15048 WP_001029580.1.15058 WP_001029580.1.15061 WP_001029580.1.1507 WP_001029580.1.15081 WP_001029580.1.15086 WP_001029580.1.15104 WP_001029580.1.15128 WP_001029580.1.15135 WP_001029580.1.15139 WP_001029580.1.15141 WP_001029580.1.15142 WP_001029580.1.15149 WP_001029580.1.1515 WP_001029580.1.15155 WP_001029580.1.15157 WP_001029580.1.15189 WP_001029580.1.1522 WP_001029580.1.15220 WP_001029580.1.15254 WP_001029580.1.15266 WP_001029580.1.15305 WP_001029580.1.15344 WP_001029580.1.15366 WP_001029580.1.15370 WP_001029580.1.15390 WP_001029580.1.15391 WP_001029580.1.15395 WP_001029580.1.15396 WP_001029580.1.15405 WP_001029580.1.1541 WP_001029580.1.15425 WP_001029580.1.15440 WP_001029580.1.1549 WP_001029580.1.15498 WP_001029580.1.15504 WP_001029580.1.15506 WP_001029580.1.15509 WP_001029580.1.15513 WP_001029580.1.15523 WP_001029580.1.15552 WP_001029580.1.15575 WP_001029580.1.15578 WP_001029580.1.15588 WP_001029580.1.15596 WP_001029580.1.15607 WP_001029580.1.15635 WP_001029580.1.15639 WP_001029580.1.15648 WP_001029580.1.15650 WP_001029580.1.1566 WP_001029580.1.15661 WP_001029580.1.15671 WP_001029580.1.15683 WP_001029580.1.15690 WP_001029580.1.15701 WP_001029580.1.15709 WP_001029580.1.15720 WP_001029580.1.15759 WP_001029580.1.15761 WP_001029580.1.15787 WP_001029580.1.15788 WP_001029580.1.15797 WP_001029580.1.15798 WP_001029580.1.15800 WP_001029580.1.1584 WP_001029580.1.15841 WP_001029580.1.15844 WP_001029580.1.15849 WP_001029580.1.15854 WP_001029580.1.15891 WP_001029580.1.1590 WP_001029580.1.15907 WP_001029580.1.15917 WP_001029580.1.15918 WP_001029580.1.15935 WP_001029580.1.15943 WP_001029580.1.15955 WP_001029580.1.15965 WP_001029580.1.15967 WP_001029580.1.15968 WP_001029580.1.15992 WP_001029580.1.16005 WP_001029580.1.16049 WP_001029580.1.16053 WP_001029580.1.16056 WP_001029580.1.16064 WP_001029580.1.16093 WP_001029580.1.16094 WP_001029580.1.16101 WP_001029580.1.16118 WP_001029580.1.16181 WP_001029580.1.16184 WP_001029580.1.16218 WP_001029580.1.16220 WP_001029580.1.16229 WP_001029580.1.16240 WP_001029580.1.16281 WP_001029580.1.16282 WP_001029580.1.16287 WP_001029580.1.16290 WP_001029580.1.16302 WP_001029580.1.16306 WP_001029580.1.16316 WP_001029580.1.16317 WP_001029580.1.16323 WP_001029580.1.16330 WP_001029580.1.16336 WP_001029580.1.16337 WP_001029580.1.16357 WP_001029580.1.16359 WP_001029580.1.16375 WP_001029580.1.16381 WP_001029580.1.16404 WP_001029580.1.16437 WP_001029580.1.16441 WP_001029580.1.16457 WP_001029580.1.16470 WP_001029580.1.16479 WP_001029580.1.16509 WP_001029580.1.16514 WP_001029580.1.16521 WP_001029580.1.16527 WP_001029580.1.16543 WP_001029580.1.16550 WP_001029580.1.16555 WP_001029580.1.16568 WP_001029580.1.16570 WP_001029580.1.16575 WP_001029580.1.16630 WP_001029580.1.16662 WP_001029580.1.16676 WP_001029580.1.1672 WP_001029580.1.16727 WP_001029580.1.16730 WP_001029580.1.16741 WP_001029580.1.16778 WP_001029580.1.16793 WP_001029580.1.168 WP_001029580.1.16803 WP_001029580.1.16813 WP_001029580.1.16814 WP_001029580.1.1682 WP_001029580.1.16831 WP_001029580.1.16832 WP_001029580.1.1684 WP_001029580.1.1686 WP_001029580.1.16884 WP_001029580.1.16886 WP_001029580.1.16889 WP_001029580.1.16902 WP_001029580.1.16904 WP_001029580.1.16911 WP_001029580.1.16947 WP_001029580.1.16952 WP_001029580.1.16955 WP_001029580.1.16974 WP_001029580.1.1698 WP_001029580.1.16981 WP_001029580.1.17003 WP_001029580.1.17029 WP_001029580.1.17033 WP_001029580.1.17045 WP_001029580.1.17063 WP_001029580.1.17091 WP_001029580.1.1711 WP_001029580.1.17133 WP_001029580.1.1714 WP_001029580.1.17144 WP_001029580.1.17163 WP_001029580.1.17178 WP_001029580.1.17214 WP_001029580.1.17220 WP_001029580.1.17227 WP_001029580.1.17229 WP_001029580.1.17238 WP_001029580.1.1724 WP_001029580.1.17252 WP_001029580.1.17257 WP_001029580.1.17263 WP_001029580.1.17269 WP_001029580.1.17279 WP_001029580.1.17286 WP_001029580.1.17291 WP_001029580.1.17312 WP_001029580.1.17315 WP_001029580.1.17330 WP_001029580.1.17340 WP_001029580.1.17355 WP_001029580.1.17363 WP_001029580.1.17372 WP_001029580.1.17411 WP_001029580.1.1742 WP_001029580.1.17420 WP_001029580.1.17426 WP_001029580.1.17438 WP_001029580.1.17470 WP_001029580.1.17474 WP_001029580.1.17532 WP_001029580.1.17562 WP_001029580.1.17571 WP_001029580.1.17601 WP_001029580.1.17609 WP_001029580.1.17630 WP_001029580.1.17639 WP_001029580.1.17641 WP_001029580.1.17652 WP_001029580.1.17665 WP_001029580.1.17672 WP_001029580.1.17677 WP_001029580.1.17690 WP_001029580.1.17691 WP_001029580.1.17692 WP_001029580.1.17706 WP_001029580.1.17715 WP_001029580.1.17716 WP_001029580.1.17775 WP_001029580.1.17776 WP_001029580.1.17784 WP_001029580.1.17810 WP_001029580.1.17820 WP_001029580.1.17822 WP_001029580.1.1783 WP_001029580.1.17839 WP_001029580.1.17844 WP_001029580.1.17858 WP_001029580.1.17888 WP_001029580.1.17892 WP_001029580.1.17895 WP_001029580.1.17917 WP_001029580.1.17933 WP_001029580.1.17942 WP_001029580.1.17954 WP_001029580.1.17965 WP_001029580.1.17971 WP_001029580.1.17972 WP_001029580.1.180 WP_001029580.1.18012 WP_001029580.1.18018 WP_001029580.1.18040 WP_001029580.1.18067 WP_001029580.1.18081 WP_001029580.1.18100 WP_001029580.1.18130 WP_001029580.1.18131 WP_001029580.1.18147 WP_001029580.1.18166 WP_001029580.1.18180 WP_001029580.1.18193 WP_001029580.1.18215 WP_001029580.1.18230 WP_001029580.1.18244 WP_001029580.1.18258 WP_001029580.1.1826 WP_001029580.1.18266 WP_001029580.1.18276 WP_001029580.1.18278 WP_001029580.1.18279 WP_001029580.1.18285 WP_001029580.1.18342 WP_001029580.1.18357 WP_001029580.1.18361 WP_001029580.1.1839 WP_001029580.1.184 WP_001029580.1.18404 WP_001029580.1.18415 WP_001029580.1.18417 WP_001029580.1.18423 WP_001029580.1.18449 WP_001029580.1.18457 WP_001029580.1.1846 WP_001029580.1.18460 WP_001029580.1.18464 WP_001029580.1.18481 WP_001029580.1.18488 WP_001029580.1.18496 WP_001029580.1.18514 WP_001029580.1.18521 WP_001029580.1.18528 WP_001029580.1.18534 WP_001029580.1.18555 WP_001029580.1.1856 WP_001029580.1.18571 WP_001029580.1.18572 WP_001029580.1.18597 WP_001029580.1.18619 WP_001029580.1.18630 WP_001029580.1.18634 WP_001029580.1.18638 WP_001029580.1.18652 WP_001029580.1.18670 WP_001029580.1.18687 WP_001029580.1.18712 WP_001029580.1.1872 WP_001029580.1.18733 WP_001029580.1.18764 WP_001029580.1.18768 WP_001029580.1.18770 WP_001029580.1.18771 WP_001029580.1.18773 WP_001029580.1.18831 WP_001029580.1.18864 WP_001029580.1.18869 WP_001029580.1.1887 WP_001029580.1.18884 WP_001029580.1.18894 WP_001029580.1.18920 WP_001029580.1.18928 WP_001029580.1.1894 WP_001029580.1.18946 WP_001029580.1.18948 WP_001029580.1.18955 WP_001029580.1.18999 WP_001029580.1.19000 WP_001029580.1.19003 WP_001029580.1.19010 WP_001029580.1.19015 WP_001029580.1.1902 WP_001029580.1.19045 WP_001029580.1.19049 WP_001029580.1.19060 WP_001029580.1.19103 WP_001029580.1.19104 WP_001029580.1.19124 WP_001029580.1.19127 WP_001029580.1.19157 WP_001029580.1.19162 WP_001029580.1.19166 WP_001029580.1.19172 WP_001029580.1.19190 WP_001029580.1.19201 WP_001029580.1.19216 WP_001029580.1.19218 WP_001029580.1.19236 WP_001029580.1.19237 WP_001029580.1.19267 WP_001029580.1.19275 WP_001029580.1.19359 WP_001029580.1.19368 WP_001029580.1.19385 WP_001029580.1.19392 WP_001029580.1.19413 WP_001029580.1.19420 WP_001029580.1.19467 WP_001029580.1.19470 WP_001029580.1.19489 WP_001029580.1.19490 WP_001029580.1.19493 WP_001029580.1.19510 WP_001029580.1.19513 WP_001029580.1.19527 WP_001029580.1.19530 WP_001029580.1.19532 WP_001029580.1.19558 WP_001029580.1.19559 WP_001029580.1.1956 WP_001029580.1.19603 WP_001029580.1.19631 WP_001029580.1.19633 WP_001029580.1.19677 WP_001029580.1.19698 WP_001029580.1.19719 WP_001029580.1.19721 WP_001029580.1.19729 WP_001029580.1.19730 WP_001029580.1.19754 WP_001029580.1.19827 WP_001029580.1.1983 WP_001029580.1.19832 WP_001029580.1.19837 WP_001029580.1.1985 WP_001029580.1.19856 WP_001029580.1.19879 WP_001029580.1.19880 WP_001029580.1.19925 WP_001029580.1.19942 WP_001029580.1.1996 WP_001029580.1.19961 WP_001029580.1.19965 WP_001029580.1.19983 WP_001029580.1.19995 WP_001029580.1.19998 WP_001029580.1.20008 WP_001029580.1.20011 WP_001029580.1.20015 WP_001029580.1.20041 WP_001029580.1.20045 WP_001029580.1.20079 WP_001029580.1.20105 WP_001029580.1.20108 WP_001029580.1.20110 WP_001029580.1.20124 WP_001029580.1.20149 WP_001029580.1.20185 WP_001029580.1.20207 WP_001029580.1.20209 WP_001029580.1.20213 WP_001029580.1.20227 WP_001029580.1.20241 WP_001029580.1.20250 WP_001029580.1.20274 WP_001029580.1.20279 WP_001029580.1.20281 WP_001029580.1.20298 WP_001029580.1.203 WP_001029580.1.20312 WP_001029580.1.20328 WP_001029580.1.20363 WP_001029580.1.20374 WP_001029580.1.20382 WP_001029580.1.20385 WP_001029580.1.20407 WP_001029580.1.20408 WP_001029580.1.20421 WP_001029580.1.20422 WP_001029580.1.20451 WP_001029580.1.20470 WP_001029580.1.2048 WP_001029580.1.20486 WP_001029580.1.20491 WP_001029580.1.20509 WP_001029580.1.20568 WP_001029580.1.2060 WP_001029580.1.20634 WP_001029580.1.20657 WP_001029580.1.20671 WP_001029580.1.20693 WP_001029580.1.207 WP_001029580.1.20701 WP_001029580.1.20711 WP_001029580.1.20719 WP_001029580.1.20766 WP_001029580.1.2078 WP_001029580.1.20781 WP_001029580.1.20782 WP_001029580.1.20805 WP_001029580.1.20837 WP_001029580.1.20856 WP_001029580.1.20858 WP_001029580.1.20892 WP_001029580.1.20899 WP_001029580.1.20909 WP_001029580.1.20915 WP_001029580.1.20934 WP_001029580.1.20952 WP_001029580.1.20965 WP_001029580.1.20969 WP_001029580.1.20976 WP_001029580.1.20981 WP_001029580.1.20984 WP_001029580.1.20988 WP_001029580.1.20996 WP_001029580.1.21028 WP_001029580.1.21090 WP_001029580.1.21095 WP_001029580.1.21097 WP_001029580.1.21174 WP_001029580.1.21175 WP_001029580.1.21176 WP_001029580.1.21192 WP_001029580.1.21211 WP_001029580.1.21214 WP_001029580.1.21216 WP_001029580.1.21230 WP_001029580.1.21233 WP_001029580.1.21244 WP_001029580.1.21256 WP_001029580.1.21271 WP_001029580.1.21278 WP_001029580.1.21297 WP_001029580.1.213 WP_001029580.1.21329 WP_001029580.1.21331 WP_001029580.1.21355 WP_001029580.1.21370 WP_001029580.1.21377 WP_001029580.1.21381 WP_001029580.1.21394 WP_001029580.1.21421 WP_001029580.1.21422 WP_001029580.1.21426 WP_001029580.1.21433 WP_001029580.1.21435 WP_001029580.1.21436 WP_001029580.1.21445 WP_001029580.1.21452 WP_001029580.1.2147 WP_001029580.1.21472 WP_001029580.1.2148 WP_001029580.1.21490 WP_001029580.1.21503 WP_001029580.1.21507 WP_001029580.1.2152 WP_001029580.1.21551 WP_001029580.1.21599 WP_001029580.1.21604 WP_001029580.1.21605 WP_001029580.1.21610 WP_001029580.1.21612 WP_001029580.1.21620 WP_001029580.1.21630 WP_001029580.1.2167 WP_001029580.1.21675 WP_001029580.1.21682 WP_001029580.1.21684 WP_001029580.1.21685 WP_001029580.1.21691 WP_001029580.1.21699 WP_001029580.1.21701 WP_001029580.1.2173 WP_001029580.1.21735 WP_001029580.1.21753 WP_001029580.1.21780 WP_001029580.1.21781 WP_001029580.1.21788 WP_001029580.1.21790 WP_001029580.1.2180 WP_001029580.1.21807 WP_001029580.1.21816 WP_001029580.1.21821 WP_001029580.1.21822 WP_001029580.1.21824 WP_001029580.1.21838 WP_001029580.1.21848 WP_001029580.1.21904 WP_001029580.1.21949 WP_001029580.1.21957 WP_001029580.1.2197 WP_001029580.1.21979 WP_001029580.1.21990 WP_001029580.1.21997 WP_001029580.1.21998 WP_001029580.1.22 WP_001029580.1.22014 WP_001029580.1.22016 WP_001029580.1.2202 WP_001029580.1.2203 WP_001029580.1.22035 WP_001029580.1.22048 WP_001029580.1.22057 WP_001029580.1.22058 WP_001029580.1.22061 WP_001029580.1.22083 WP_001029580.1.22119 WP_001029580.1.22121 WP_001029580.1.22122 WP_001029580.1.22135 WP_001029580.1.22146 WP_001029580.1.22179 WP_001029580.1.22186 WP_001029580.1.22196 WP_001029580.1.22262 WP_001029580.1.22263 WP_001029580.1.22271 WP_001029580.1.22297 WP_001029580.1.223 WP_001029580.1.22338 WP_001029580.1.22341 WP_001029580.1.22343 WP_001029580.1.22368 WP_001029580.1.22382 WP_001029580.1.22392 WP_001029580.1.22397 WP_001029580.1.22422 WP_001029580.1.22436 WP_001029580.1.22439 WP_001029580.1.22457 WP_001029580.1.22480 WP_001029580.1.22497 WP_001029580.1.22503 WP_001029580.1.22505 WP_001029580.1.22506 WP_001029580.1.22513 WP_001029580.1.22546 WP_001029580.1.2255 WP_001029580.1.22550 WP_001029580.1.22554 WP_001029580.1.22556 WP_001029580.1.22561 WP_001029580.1.22563 WP_001029580.1.2257 WP_001029580.1.22591 WP_001029580.1.22596 WP_001029580.1.2260 WP_001029580.1.22612 WP_001029580.1.22616 WP_001029580.1.2263 WP_001029580.1.22636 WP_001029580.1.22638 WP_001029580.1.22640 WP_001029580.1.22643 WP_001029580.1.22655 WP_001029580.1.22675 WP_001029580.1.22677 WP_001029580.1.22700 WP_001029580.1.22711 WP_001029580.1.22717 WP_001029580.1.22720 WP_001029580.1.22723 WP_001029580.1.22745 WP_001029580.1.22751 WP_001029580.1.22761 WP_001029580.1.22763 WP_001029580.1.22772 WP_001029580.1.22784 WP_001029580.1.22791 WP_001029580.1.22820 WP_001029580.1.22839 WP_001029580.1.22884 WP_001029580.1.22897 WP_001029580.1.22904 WP_001029580.1.2291 WP_001029580.1.22938 WP_001029580.1.22941 WP_001029580.1.2295 WP_001029580.1.22955 WP_001029580.1.2296 WP_001029580.1.2297 WP_001029580.1.22976 WP_001029580.1.23018 WP_001029580.1.23025 WP_001029580.1.23028 WP_001029580.1.23031 WP_001029580.1.23039 WP_001029580.1.23066 WP_001029580.1.23076 WP_001029580.1.23077 WP_001029580.1.23083 WP_001029580.1.2310 WP_001029580.1.23107 WP_001029580.1.2311 WP_001029580.1.23111 WP_001029580.1.23138 WP_001029580.1.23177 WP_001029580.1.23178 WP_001029580.1.2319 WP_001029580.1.23256 WP_001029580.1.23276 WP_001029580.1.2328 WP_001029580.1.23313 WP_001029580.1.23320 WP_001029580.1.23334 WP_001029580.1.23354 WP_001029580.1.23397 WP_001029580.1.23415 WP_001029580.1.23432 WP_001029580.1.23477 WP_001029580.1.23481 WP_001029580.1.23536 WP_001029580.1.23597 WP_001029580.1.23602 WP_001029580.1.23606 WP_001029580.1.2361 WP_001029580.1.23620 WP_001029580.1.23633 WP_001029580.1.23635 WP_001029580.1.23649 WP_001029580.1.23656 WP_001029580.1.23659 WP_001029580.1.23668 WP_001029580.1.23696 WP_001029580.1.23713 WP_001029580.1.23722 WP_001029580.1.23742 WP_001029580.1.23791 WP_001029580.1.23798 WP_001029580.1.23800 WP_001029580.1.23847 WP_001029580.1.23853 WP_001029580.1.23889 WP_001029580.1.239 WP_001029580.1.23903 WP_001029580.1.23912 WP_001029580.1.23929 WP_001029580.1.23930 WP_001029580.1.23937 WP_001029580.1.23964 WP_001029580.1.23966 WP_001029580.1.23968 WP_001029580.1.23978 WP_001029580.1.23988 WP_001029580.1.24010 WP_001029580.1.24040 WP_001029580.1.24043 WP_001029580.1.24067 WP_001029580.1.24094 WP_001029580.1.24098 WP_001029580.1.24102 WP_001029580.1.24116 WP_001029580.1.24146 WP_001029580.1.24203 WP_001029580.1.24218 WP_001029580.1.24220 WP_001029580.1.24222 WP_001029580.1.24247 WP_001029580.1.24252 WP_001029580.1.24281 WP_001029580.1.24288 WP_001029580.1.2429 WP_001029580.1.243 WP_001029580.1.2431 WP_001029580.1.24312 WP_001029580.1.24318 WP_001029580.1.24324 WP_001029580.1.24356 WP_001029580.1.24379 WP_001029580.1.24395 WP_001029580.1.2444 WP_001029580.1.24440 WP_001029580.1.24466 WP_001029580.1.24467 WP_001029580.1.24471 WP_001029580.1.24481 WP_001029580.1.24497 WP_001029580.1.24501 WP_001029580.1.24522 WP_001029580.1.24540 WP_001029580.1.24542 WP_001029580.1.24552 WP_001029580.1.24562 WP_001029580.1.24573 WP_001029580.1.24574 WP_001029580.1.24598 WP_001029580.1.2461 WP_001029580.1.24610 WP_001029580.1.24620 WP_001029580.1.24627 WP_001029580.1.24630 WP_001029580.1.24649 WP_001029580.1.2465 WP_001029580.1.24653 WP_001029580.1.24658 WP_001029580.1.24677 WP_001029580.1.24678 WP_001029580.1.24724 WP_001029580.1.24742 WP_001029580.1.24772 WP_001029580.1.24788 WP_001029580.1.24812 WP_001029580.1.24825 WP_001029580.1.24835 WP_001029580.1.24844 WP_001029580.1.24852 WP_001029580.1.24861 WP_001029580.1.24871 WP_001029580.1.24874 WP_001029580.1.249 WP_001029580.1.24910 WP_001029580.1.24928 WP_001029580.1.24943 WP_001029580.1.24947 WP_001029580.1.24970 WP_001029580.1.24993 WP_001029580.1.25005 WP_001029580.1.2503 WP_001029580.1.25084 WP_001029580.1.25106 WP_001029580.1.25121 WP_001029580.1.25124 WP_001029580.1.25139 WP_001029580.1.25153 WP_001029580.1.25155 WP_001029580.1.25186 WP_001029580.1.252 WP_001029580.1.25202 WP_001029580.1.25222 WP_001029580.1.25226 WP_001029580.1.25228 WP_001029580.1.25242 WP_001029580.1.25264 WP_001029580.1.25293 WP_001029580.1.25337 WP_001029580.1.25340 WP_001029580.1.25351 WP_001029580.1.25366 WP_001029580.1.2538 WP_001029580.1.25383 WP_001029580.1.25384 WP_001029580.1.25424 WP_001029580.1.25432 WP_001029580.1.25439 WP_001029580.1.25442 WP_001029580.1.25461 WP_001029580.1.25472 WP_001029580.1.2548 WP_001029580.1.25483 WP_001029580.1.25494 WP_001029580.1.25502 WP_001029580.1.25507 WP_001029580.1.2553 WP_001029580.1.25538 WP_001029580.1.25545 WP_001029580.1.25553 WP_001029580.1.2556 WP_001029580.1.25571 WP_001029580.1.25581 WP_001029580.1.25589 WP_001029580.1.25662 WP_001029580.1.25684 WP_001029580.1.25685 WP_001029580.1.25696 WP_001029580.1.25707 WP_001029580.1.25714 WP_001029580.1.25749 WP_001029580.1.25754 WP_001029580.1.25767 WP_001029580.1.25768 WP_001029580.1.25771 WP_001029580.1.25783 WP_001029580.1.25791 WP_001029580.1.25792 WP_001029580.1.25845 WP_001029580.1.2586 WP_001029580.1.25875 WP_001029580.1.25880 WP_001029580.1.25883 WP_001029580.1.25888 WP_001029580.1.25897 WP_001029580.1.25905 WP_001029580.1.25909 WP_001029580.1.25934 WP_001029580.1.25952 WP_001029580.1.25958 WP_001029580.1.25966 WP_001029580.1.25982 WP_001029580.1.25986 WP_001029580.1.25994 WP_001029580.1.26021 WP_001029580.1.26041 WP_001029580.1.26059 WP_001029580.1.26062 WP_001029580.1.2607 WP_001029580.1.26078 WP_001029580.1.26085 WP_001029580.1.2610 WP_001029580.1.26111 WP_001029580.1.26112 WP_001029580.1.26141 WP_001029580.1.26180 WP_001029580.1.26208 WP_001029580.1.26218 WP_001029580.1.26220 WP_001029580.1.26257 WP_001029580.1.26279 WP_001029580.1.26280 WP_001029580.1.2629 WP_001029580.1.26317 WP_001029580.1.26344 WP_001029580.1.26369 WP_001029580.1.26371 WP_001029580.1.26389 WP_001029580.1.26392 WP_001029580.1.26413 WP_001029580.1.26432 WP_001029580.1.26447 WP_001029580.1.2647 WP_001029580.1.26470 WP_001029580.1.26484 WP_001029580.1.26490 WP_001029580.1.26496 WP_001029580.1.26497 WP_001029580.1.26518 WP_001029580.1.26544 WP_001029580.1.26566 WP_001029580.1.26578 WP_001029580.1.26625 WP_001029580.1.26653 WP_001029580.1.26725 WP_001029580.1.26755 WP_001029580.1.26781 WP_001029580.1.26785 WP_001029580.1.26793 WP_001029580.1.26799 WP_001029580.1.26807 WP_001029580.1.26818 WP_001029580.1.26823 WP_001029580.1.26848 WP_001029580.1.26855 WP_001029580.1.26858 WP_001029580.1.26863 WP_001029580.1.26875 WP_001029580.1.26877 WP_001029580.1.26879 WP_001029580.1.26900 WP_001029580.1.26901 WP_001029580.1.26910 WP_001029580.1.26918 WP_001029580.1.26925 WP_001029580.1.26926 WP_001029580.1.26953 WP_001029580.1.26968 WP_001029580.1.26983 WP_001029580.1.26985 WP_001029580.1.26988 WP_001029580.1.26990 WP_001029580.1.26994 WP_001029580.1.27001 WP_001029580.1.27007 WP_001029580.1.27022 WP_001029580.1.2703 WP_001029580.1.27046 WP_001029580.1.27047 WP_001029580.1.27071 WP_001029580.1.27078 WP_001029580.1.27119 WP_001029580.1.27131 WP_001029580.1.27135 WP_001029580.1.27149 WP_001029580.1.27151 WP_001029580.1.27174 WP_001029580.1.27203 WP_001029580.1.2721 WP_001029580.1.27210 WP_001029580.1.27219 WP_001029580.1.2724 WP_001029580.1.27252 WP_001029580.1.27267 WP_001029580.1.27289 WP_001029580.1.2729 WP_001029580.1.27308 WP_001029580.1.27312 WP_001029580.1.27315 WP_001029580.1.27324 WP_001029580.1.2735 WP_001029580.1.27362 WP_001029580.1.27382 WP_001029580.1.27392 WP_001029580.1.27394 WP_001029580.1.27405 WP_001029580.1.27418 WP_001029580.1.27421 WP_001029580.1.27428 WP_001029580.1.27432 WP_001029580.1.27440 WP_001029580.1.27479 WP_001029580.1.27484 WP_001029580.1.2750 WP_001029580.1.27514 WP_001029580.1.2752 WP_001029580.1.27573 WP_001029580.1.27581 WP_001029580.1.27589 WP_001029580.1.276 WP_001029580.1.27601 WP_001029580.1.27610 WP_001029580.1.27636 WP_001029580.1.27653 WP_001029580.1.27661 WP_001029580.1.27684 WP_001029580.1.27686 WP_001029580.1.27690 WP_001029580.1.27714 WP_001029580.1.27721 WP_001029580.1.27740 WP_001029580.1.27746 WP_001029580.1.27759 WP_001029580.1.27768 WP_001029580.1.27789 WP_001029580.1.27791 WP_001029580.1.27808 WP_001029580.1.27829 WP_001029580.1.27853 WP_001029580.1.27862 WP_001029580.1.27865 WP_001029580.1.27866 WP_001029580.1.27868 WP_001029580.1.27886 WP_001029580.1.27887 WP_001029580.1.27904 WP_001029580.1.27907 WP_001029580.1.27912 WP_001029580.1.27964 WP_001029580.1.27970 WP_001029580.1.27984 WP_001029580.1.27988 WP_001029580.1.28014 WP_001029580.1.28028 WP_001029580.1.28050 WP_001029580.1.28058 WP_001029580.1.28068 WP_001029580.1.28089 WP_001029580.1.28121 WP_001029580.1.28140 WP_001029580.1.28146 WP_001029580.1.28151 WP_001029580.1.28164 WP_001029580.1.28180 WP_001029580.1.28183 WP_001029580.1.28228 WP_001029580.1.28231 WP_001029580.1.28248 WP_001029580.1.28259 WP_001029580.1.28264 WP_001029580.1.2827 WP_001029580.1.28296 WP_001029580.1.2830 WP_001029580.1.28307 WP_001029580.1.28326 WP_001029580.1.28350 WP_001029580.1.28353 WP_001029580.1.28379 WP_001029580.1.28408 WP_001029580.1.28450 WP_001029580.1.28451 WP_001029580.1.28458 WP_001029580.1.28460 WP_001029580.1.28519 WP_001029580.1.28522 WP_001029580.1.28524 WP_001029580.1.28537 WP_001029580.1.28542 WP_001029580.1.28548 WP_001029580.1.28549 WP_001029580.1.2857 WP_001029580.1.28572 WP_001029580.1.28574 WP_001029580.1.28589 WP_001029580.1.28608 WP_001029580.1.2861 WP_001029580.1.28643 WP_001029580.1.28659 WP_001029580.1.28667 WP_001029580.1.2868 WP_001029580.1.28680 WP_001029580.1.28708 WP_001029580.1.28709 WP_001029580.1.28714 WP_001029580.1.28740 WP_001029580.1.28746 WP_001029580.1.28761 WP_001029580.1.28767 WP_001029580.1.28771 WP_001029580.1.28772 WP_001029580.1.28790 WP_001029580.1.28794 WP_001029580.1.28812 WP_001029580.1.28816 WP_001029580.1.2882 WP_001029580.1.28836 WP_001029580.1.28846 WP_001029580.1.28867 WP_001029580.1.28868 WP_001029580.1.28869 WP_001029580.1.2888 WP_001029580.1.28892 WP_001029580.1.28931 WP_001029580.1.28945 WP_001029580.1.28956 WP_001029580.1.28986 WP_001029580.1.28997 WP_001029580.1.2900 WP_001029580.1.29018 WP_001029580.1.29039 WP_001029580.1.29041 WP_001029580.1.29046 WP_001029580.1.29069 WP_001029580.1.29076 WP_001029580.1.2909 WP_001029580.1.29098 WP_001029580.1.29104 WP_001029580.1.2911 WP_001029580.1.29151 WP_001029580.1.29175 WP_001029580.1.29181 WP_001029580.1.29192 WP_001029580.1.292 WP_001029580.1.29204 WP_001029580.1.29205 WP_001029580.1.29210 WP_001029580.1.2922 WP_001029580.1.29222 WP_001029580.1.29232 WP_001029580.1.29249 WP_001029580.1.29253 WP_001029580.1.29266 WP_001029580.1.29269 WP_001029580.1.29280 WP_001029580.1.29286 WP_001029580.1.29289 WP_001029580.1.29300 WP_001029580.1.29307 WP_001029580.1.29311 WP_001029580.1.29317 WP_001029580.1.29321 WP_001029580.1.29338 WP_001029580.1.29343 WP_001029580.1.29351 WP_001029580.1.29360 WP_001029580.1.2940 WP_001029580.1.29406 WP_001029580.1.29442 WP_001029580.1.29469 WP_001029580.1.29473 WP_001029580.1.295 WP_001029580.1.2951 WP_001029580.1.29517 WP_001029580.1.29536 WP_001029580.1.29549 WP_001029580.1.29572 WP_001029580.1.29624 WP_001029580.1.29628 WP_001029580.1.29642 WP_001029580.1.29653 WP_001029580.1.2966 WP_001029580.1.29687 WP_001029580.1.29694 WP_001029580.1.2970 WP_001029580.1.29702 WP_001029580.1.29712 WP_001029580.1.29730 WP_001029580.1.29734 WP_001029580.1.29751 WP_001029580.1.29783 WP_001029580.1.29810 WP_001029580.1.29852 WP_001029580.1.29894 WP_001029580.1.29921 WP_001029580.1.29929 WP_001029580.1.29940 WP_001029580.1.29944 WP_001029580.1.29951 WP_001029580.1.29980 WP_001029580.1.29996 WP_001029580.1.30011 WP_001029580.1.30038 WP_001029580.1.30055 WP_001029580.1.30065 WP_001029580.1.30102 WP_001029580.1.3011 WP_001029580.1.30119 WP_001029580.1.30133 WP_001029580.1.30134 WP_001029580.1.30135 WP_001029580.1.30137 WP_001029580.1.30151 WP_001029580.1.30167 WP_001029580.1.3019 WP_001029580.1.30199 WP_001029580.1.30205 WP_001029580.1.30219 WP_001029580.1.30229 WP_001029580.1.30233 WP_001029580.1.30234 WP_001029580.1.30243 WP_001029580.1.30245 WP_001029580.1.30250 WP_001029580.1.30255 WP_001029580.1.30287 WP_001029580.1.30290 WP_001029580.1.30297 WP_001029580.1.30301 WP_001029580.1.30316 WP_001029580.1.30326 WP_001029580.1.30335 WP_001029580.1.30342 WP_001029580.1.30368 WP_001029580.1.30370 WP_001029580.1.30387 WP_001029580.1.3040 WP_001029580.1.30405 WP_001029580.1.30406 WP_001029580.1.30435 WP_001029580.1.30443 WP_001029580.1.30446 WP_001029580.1.30480 WP_001029580.1.30481 WP_001029580.1.30514 WP_001029580.1.30515 WP_001029580.1.30538 WP_001029580.1.30543 WP_001029580.1.30545 WP_001029580.1.30549 WP_001029580.1.30564 WP_001029580.1.3058 WP_001029580.1.30591 WP_001029580.1.30607 WP_001029580.1.3061 WP_001029580.1.30612 WP_001029580.1.30647 WP_001029580.1.30672 WP_001029580.1.30676 WP_001029580.1.30705 WP_001029580.1.30711 WP_001029580.1.30712 WP_001029580.1.30755 WP_001029580.1.30757 WP_001029580.1.30795 WP_001029580.1.3084 WP_001029580.1.3085 WP_001029580.1.30864 WP_001029580.1.30869 WP_001029580.1.30891 WP_001029580.1.30923 WP_001029580.1.30933 WP_001029580.1.30942 WP_001029580.1.30948 WP_001029580.1.30956 WP_001029580.1.3096 WP_001029580.1.30964 WP_001029580.1.30982 WP_001029580.1.30984 WP_001029580.1.31004 WP_001029580.1.31006 WP_001029580.1.31031 WP_001029580.1.3105 WP_001029580.1.31059 WP_001029580.1.3106 WP_001029580.1.31082 WP_001029580.1.31099 WP_001029580.1.31164 WP_001029580.1.31169 WP_001029580.1.31191 WP_001029580.1.31216 WP_001029580.1.31256 WP_001029580.1.31275 WP_001029580.1.31276 WP_001029580.1.31283 WP_001029580.1.3133 WP_001029580.1.31333 WP_001029580.1.31334 WP_001029580.1.31367 WP_001029580.1.31383 WP_001029580.1.31420 WP_001029580.1.31427 WP_001029580.1.31439 WP_001029580.1.31443 WP_001029580.1.31464 WP_001029580.1.31466 WP_001029580.1.31488 WP_001029580.1.31493 WP_001029580.1.31499 WP_001029580.1.3152 WP_001029580.1.31522 WP_001029580.1.31528 WP_001029580.1.31545 WP_001029580.1.3155 WP_001029580.1.31550 WP_001029580.1.31553 WP_001029580.1.3156 WP_001029580.1.31566 WP_001029580.1.31574 WP_001029580.1.31586 WP_001029580.1.31603 WP_001029580.1.3161 WP_001029580.1.31619 WP_001029580.1.31620 WP_001029580.1.31651 WP_001029580.1.31652 WP_001029580.1.31688 WP_001029580.1.31695 WP_001029580.1.31705 WP_001029580.1.31735 WP_001029580.1.31755 WP_001029580.1.31757 WP_001029580.1.31759 WP_001029580.1.31767 WP_001029580.1.3178 WP_001029580.1.31780 WP_001029580.1.31822 WP_001029580.1.31859 WP_001029580.1.31876 WP_001029580.1.31887 WP_001029580.1.31889 WP_001029580.1.3191 WP_001029580.1.31915 WP_001029580.1.31935 WP_001029580.1.31945 WP_001029580.1.31974 WP_001029580.1.31979 WP_001029580.1.31989 WP_001029580.1.31996 WP_001029580.1.320 WP_001029580.1.32027 WP_001029580.1.32032 WP_001029580.1.32035 WP_001029580.1.32058 WP_001029580.1.32068 WP_001029580.1.32079 WP_001029580.1.32080 WP_001029580.1.32083 WP_001029580.1.32084 WP_001029580.1.32097 WP_001029580.1.32108 WP_001029580.1.3211 WP_001029580.1.32110 WP_001029580.1.32117 WP_001029580.1.32128 WP_001029580.1.32139 WP_001029580.1.32171 WP_001029580.1.32186 WP_001029580.1.32187 WP_001029580.1.3221 WP_001029580.1.32233 WP_001029580.1.32246 WP_001029580.1.32261 WP_001029580.1.32280 WP_001029580.1.32282 WP_001029580.1.32288 WP_001029580.1.32290 WP_001029580.1.32296 WP_001029580.1.32303 WP_001029580.1.32313 WP_001029580.1.32320 WP_001029580.1.32334 WP_001029580.1.32344 WP_001029580.1.32347 WP_001029580.1.32362 WP_001029580.1.32391 WP_001029580.1.32397 WP_001029580.1.32413 WP_001029580.1.32419 WP_001029580.1.32439 WP_001029580.1.32444 WP_001029580.1.32462 WP_001029580.1.32469 WP_001029580.1.32485 WP_001029580.1.32507 WP_001029580.1.32540 WP_001029580.1.3255 WP_001029580.1.32550 WP_001029580.1.32567 WP_001029580.1.32604 WP_001029580.1.32606 WP_001029580.1.32642 WP_001029580.1.32644 WP_001029580.1.32667 WP_001029580.1.32688 WP_001029580.1.32701 WP_001029580.1.32717 WP_001029580.1.32719 WP_001029580.1.32734 WP_001029580.1.32735 WP_001029580.1.32768 WP_001029580.1.32771 WP_001029580.1.32774 WP_001029580.1.32782 WP_001029580.1.32792 WP_001029580.1.32794 WP_001029580.1.32808 WP_001029580.1.32816 WP_001029580.1.32820 WP_001029580.1.32850 WP_001029580.1.32877 WP_001029580.1.32892 WP_001029580.1.32906 WP_001029580.1.32924 WP_001029580.1.32949 WP_001029580.1.32986 WP_001029580.1.32994 WP_001029580.1.33001 WP_001029580.1.33013 WP_001029580.1.33020 WP_001029580.1.33021 WP_001029580.1.33034 WP_001029580.1.33070 WP_001029580.1.33071 WP_001029580.1.33072 WP_001029580.1.33073 WP_001029580.1.33080 WP_001029580.1.33091 WP_001029580.1.33100 WP_001029580.1.33113 WP_001029580.1.33128 WP_001029580.1.33135 WP_001029580.1.33159 WP_001029580.1.33166 WP_001029580.1.33180 WP_001029580.1.33181 WP_001029580.1.33182 WP_001029580.1.33188 WP_001029580.1.33233 WP_001029580.1.33271 WP_001029580.1.33291 WP_001029580.1.33312 WP_001029580.1.33334 WP_001029580.1.33354 WP_001029580.1.33359 WP_001029580.1.33361 WP_001029580.1.33378 WP_001029580.1.33391 WP_001029580.1.33415 WP_001029580.1.33430 WP_001029580.1.33433 WP_001029580.1.33436 WP_001029580.1.33437 WP_001029580.1.33451 WP_001029580.1.33454 WP_001029580.1.33458 WP_001029580.1.33482 WP_001029580.1.33511 WP_001029580.1.33527 WP_001029580.1.33528 WP_001029580.1.33546 WP_001029580.1.33570 WP_001029580.1.33578 WP_001029580.1.33589 WP_001029580.1.3359 WP_001029580.1.33598 WP_001029580.1.33634 WP_001029580.1.33637 WP_001029580.1.33647 WP_001029580.1.33666 WP_001029580.1.33674 WP_001029580.1.33710 WP_001029580.1.33719 WP_001029580.1.33727 WP_001029580.1.33749 WP_001029580.1.3375 WP_001029580.1.33758 WP_001029580.1.33788 WP_001029580.1.33791 WP_001029580.1.33802 WP_001029580.1.33807 WP_001029580.1.33808 WP_001029580.1.33815 WP_001029580.1.3384 WP_001029580.1.33859 WP_001029580.1.33862 WP_001029580.1.33874 WP_001029580.1.33878 WP_001029580.1.33881 WP_001029580.1.33882 WP_001029580.1.33891 WP_001029580.1.33908 WP_001029580.1.33923 WP_001029580.1.33933 WP_001029580.1.33950 WP_001029580.1.33956 WP_001029580.1.33960 WP_001029580.1.34007 WP_001029580.1.34015 WP_001029580.1.34028 WP_001029580.1.34041 WP_001029580.1.34047 WP_001029580.1.34054 WP_001029580.1.34083 WP_001029580.1.3409 WP_001029580.1.34097 WP_001029580.1.34120 WP_001029580.1.34127 WP_001029580.1.34162 WP_001029580.1.34171 WP_001029580.1.34176 WP_001029580.1.34177 WP_001029580.1.34196 WP_001029580.1.34212 WP_001029580.1.3427 WP_001029580.1.34272 WP_001029580.1.34291 WP_001029580.1.34297 WP_001029580.1.34327 WP_001029580.1.3433 WP_001029580.1.34335 WP_001029580.1.3437 WP_001029580.1.34375 WP_001029580.1.34378 WP_001029580.1.34449 WP_001029580.1.34466 WP_001029580.1.34474 WP_001029580.1.34485 WP_001029580.1.34503 WP_001029580.1.34506 WP_001029580.1.34508 WP_001029580.1.34519 WP_001029580.1.34522 WP_001029580.1.34559 WP_001029580.1.34586 WP_001029580.1.34598 WP_001029580.1.34601 WP_001029580.1.34603 WP_001029580.1.34616 WP_001029580.1.3464 WP_001029580.1.34651 WP_001029580.1.34662 WP_001029580.1.34674 WP_001029580.1.34699 WP_001029580.1.34713 WP_001029580.1.34719 WP_001029580.1.34739 WP_001029580.1.34742 WP_001029580.1.34744 WP_001029580.1.34754 WP_001029580.1.34772 WP_001029580.1.34776 WP_001029580.1.34785 WP_001029580.1.34787 WP_001029580.1.34792 WP_001029580.1.34796 WP_001029580.1.34809 WP_001029580.1.34839 WP_001029580.1.34848 WP_001029580.1.3486 WP_001029580.1.3487 WP_001029580.1.34872 WP_001029580.1.34879 WP_001029580.1.3488 WP_001029580.1.34886 WP_001029580.1.34899 WP_001029580.1.3494 WP_001029580.1.3496 WP_001029580.1.34973 WP_001029580.1.34995 WP_001029580.1.3502 WP_001029580.1.35020 WP_001029580.1.35027 WP_001029580.1.35034 WP_001029580.1.35042 WP_001029580.1.3505 WP_001029580.1.35064 WP_001029580.1.35098 WP_001029580.1.351 WP_001029580.1.35117 WP_001029580.1.35133 WP_001029580.1.35151 WP_001029580.1.35152 WP_001029580.1.35157 WP_001029580.1.35167 WP_001029580.1.35178 WP_001029580.1.35217 WP_001029580.1.35218 WP_001029580.1.35232 WP_001029580.1.35239 WP_001029580.1.35247 WP_001029580.1.35248 WP_001029580.1.35254 WP_001029580.1.3530 WP_001029580.1.35305 WP_001029580.1.3532 WP_001029580.1.35358 WP_001029580.1.3537 WP_001029580.1.35392 WP_001029580.1.35406 WP_001029580.1.35411 WP_001029580.1.35432 WP_001029580.1.35447 WP_001029580.1.35458 WP_001029580.1.35459 WP_001029580.1.35482 WP_001029580.1.35523 WP_001029580.1.35528 WP_001029580.1.35541 WP_001029580.1.35597 WP_001029580.1.356 WP_001029580.1.35614 WP_001029580.1.35616 WP_001029580.1.35625 WP_001029580.1.35634 WP_001029580.1.35640 WP_001029580.1.35655 WP_001029580.1.35665 WP_001029580.1.35685 WP_001029580.1.35708 WP_001029580.1.35721 WP_001029580.1.35727 WP_001029580.1.35735 WP_001029580.1.35743 WP_001029580.1.35763 WP_001029580.1.35773 WP_001029580.1.35798 WP_001029580.1.35827 WP_001029580.1.35834 WP_001029580.1.35836 WP_001029580.1.35851 WP_001029580.1.35875 WP_001029580.1.35882 WP_001029580.1.3589 WP_001029580.1.35919 WP_001029580.1.35920 WP_001029580.1.35924 WP_001029580.1.35925 WP_001029580.1.35932 WP_001029580.1.35943 WP_001029580.1.35957 WP_001029580.1.3596 WP_001029580.1.35960 WP_001029580.1.35967 WP_001029580.1.3597 WP_001029580.1.35972 WP_001029580.1.35974 WP_001029580.1.35981 WP_001029580.1.35986 WP_001029580.1.36002 WP_001029580.1.36054 WP_001029580.1.36060 WP_001029580.1.36077 WP_001029580.1.3608 WP_001029580.1.3609 WP_001029580.1.36090 WP_001029580.1.36109 WP_001029580.1.36124 WP_001029580.1.36131 WP_001029580.1.36139 WP_001029580.1.36144 WP_001029580.1.3616 WP_001029580.1.36160 WP_001029580.1.36162 WP_001029580.1.3618 WP_001029580.1.3619 WP_001029580.1.36206 WP_001029580.1.3621 WP_001029580.1.36214 WP_001029580.1.36230 WP_001029580.1.36234 WP_001029580.1.36242 WP_001029580.1.36247 WP_001029580.1.3625 WP_001029580.1.36272 WP_001029580.1.36300 WP_001029580.1.36317 WP_001029580.1.36330 WP_001029580.1.36377 WP_001029580.1.3638 WP_001029580.1.36382 WP_001029580.1.36404 WP_001029580.1.36429 WP_001029580.1.36448 WP_001029580.1.36450 WP_001029580.1.3646 WP_001029580.1.36463 WP_001029580.1.36471 WP_001029580.1.36476 WP_001029580.1.36479 WP_001029580.1.36486 WP_001029580.1.36492 WP_001029580.1.36493 WP_001029580.1.36510 WP_001029580.1.36538 WP_001029580.1.36546 WP_001029580.1.36552 WP_001029580.1.36554 WP_001029580.1.36568 WP_001029580.1.36591 WP_001029580.1.36641 WP_001029580.1.36651 WP_001029580.1.36653 WP_001029580.1.36688 WP_001029580.1.367 WP_001029580.1.36731 WP_001029580.1.3674 WP_001029580.1.36741 WP_001029580.1.36757 WP_001029580.1.36762 WP_001029580.1.36772 WP_001029580.1.36780 WP_001029580.1.36789 WP_001029580.1.36795 WP_001029580.1.36803 WP_001029580.1.36867 WP_001029580.1.36923 WP_001029580.1.36943 WP_001029580.1.36963 WP_001029580.1.36965 WP_001029580.1.36972 WP_001029580.1.36982 WP_001029580.1.36992 WP_001029580.1.36993 WP_001029580.1.36994 WP_001029580.1.36999 WP_001029580.1.37022 WP_001029580.1.37024 WP_001029580.1.37034 WP_001029580.1.3705 WP_001029580.1.37062 WP_001029580.1.37068 WP_001029580.1.37107 WP_001029580.1.37136 WP_001029580.1.37138 WP_001029580.1.37142 WP_001029580.1.37154 WP_001029580.1.37156 WP_001029580.1.37164 WP_001029580.1.37166 WP_001029580.1.37170 WP_001029580.1.37194 WP_001029580.1.37205 WP_001029580.1.37209 WP_001029580.1.37227 WP_001029580.1.37230 WP_001029580.1.37246 WP_001029580.1.37250 WP_001029580.1.37268 WP_001029580.1.3727 WP_001029580.1.37280 WP_001029580.1.37282 WP_001029580.1.37289 WP_001029580.1.37294 WP_001029580.1.37300 WP_001029580.1.37301 WP_001029580.1.37310 WP_001029580.1.37324 WP_001029580.1.37340 WP_001029580.1.37346 WP_001029580.1.37357 WP_001029580.1.37390 WP_001029580.1.37415 WP_001029580.1.37443 WP_001029580.1.37447 WP_001029580.1.37450 WP_001029580.1.37457 WP_001029580.1.37458 WP_001029580.1.37479 WP_001029580.1.37508 WP_001029580.1.37511 WP_001029580.1.37540 WP_001029580.1.37541 WP_001029580.1.37575 WP_001029580.1.37599 WP_001029580.1.37615 WP_001029580.1.37623 WP_001029580.1.37629 WP_001029580.1.3763 WP_001029580.1.37640 WP_001029580.1.37658 WP_001029580.1.37684 WP_001029580.1.37696 WP_001029580.1.37707 WP_001029580.1.37713 WP_001029580.1.37714 WP_001029580.1.37728 WP_001029580.1.37746 WP_001029580.1.37767 WP_001029580.1.37790 WP_001029580.1.3780 WP_001029580.1.37827 WP_001029580.1.37837 WP_001029580.1.37840 WP_001029580.1.37854 WP_001029580.1.37858 WP_001029580.1.37876 WP_001029580.1.37883 WP_001029580.1.37921 WP_001029580.1.37944 WP_001029580.1.37947 WP_001029580.1.37989 WP_001029580.1.38014 WP_001029580.1.38024 WP_001029580.1.38029 WP_001029580.1.38056 WP_001029580.1.38093 WP_001029580.1.38109 WP_001029580.1.38161 WP_001029580.1.38184 WP_001029580.1.38213 WP_001029580.1.38216 WP_001029580.1.38220 WP_001029580.1.38238 WP_001029580.1.38268 WP_001029580.1.38283 WP_001029580.1.38288 WP_001029580.1.3830 WP_001029580.1.38324 WP_001029580.1.38334 WP_001029580.1.38355 WP_001029580.1.38374 WP_001029580.1.38429 WP_001029580.1.3844 WP_001029580.1.38465 WP_001029580.1.38497 WP_001029580.1.38506 WP_001029580.1.38507 WP_001029580.1.38519 WP_001029580.1.38527 WP_001029580.1.38542 WP_001029580.1.38543 WP_001029580.1.38560 WP_001029580.1.38573 WP_001029580.1.38588 WP_001029580.1.38602 WP_001029580.1.38605 WP_001029580.1.38624 WP_001029580.1.3864 WP_001029580.1.38643 WP_001029580.1.38647 WP_001029580.1.38665 WP_001029580.1.38675 WP_001029580.1.38685 WP_001029580.1.38695 WP_001029580.1.38697 WP_001029580.1.387 WP_001029580.1.38708 WP_001029580.1.38712 WP_001029580.1.38718 WP_001029580.1.38723 WP_001029580.1.38742 WP_001029580.1.3876 WP_001029580.1.38765 WP_001029580.1.3877 WP_001029580.1.38778 WP_001029580.1.38783 WP_001029580.1.38796 WP_001029580.1.38805 WP_001029580.1.3882 WP_001029580.1.38825 WP_001029580.1.3883 WP_001029580.1.38840 WP_001029580.1.3885 WP_001029580.1.38851 WP_001029580.1.38855 WP_001029580.1.38860 WP_001029580.1.38861 WP_001029580.1.38887 WP_001029580.1.38892 WP_001029580.1.38906 WP_001029580.1.38918 WP_001029580.1.38930 WP_001029580.1.38934 WP_001029580.1.38949 WP_001029580.1.38955 WP_001029580.1.38957 WP_001029580.1.38969 WP_001029580.1.3897 WP_001029580.1.39006 WP_001029580.1.39033 WP_001029580.1.39051 WP_001029580.1.39071 WP_001029580.1.39074 WP_001029580.1.39076 WP_001029580.1.39079 WP_001029580.1.39083 WP_001029580.1.39087 WP_001029580.1.39091 WP_001029580.1.39121 WP_001029580.1.39124 WP_001029580.1.39125 WP_001029580.1.39151 WP_001029580.1.3916 WP_001029580.1.3917 WP_001029580.1.39175 WP_001029580.1.39189 WP_001029580.1.39192 WP_001029580.1.392 WP_001029580.1.39219 WP_001029580.1.39227 WP_001029580.1.39243 WP_001029580.1.39270 WP_001029580.1.3928 WP_001029580.1.39292 WP_001029580.1.39304 WP_001029580.1.39318 WP_001029580.1.3932 WP_001029580.1.39320 WP_001029580.1.39321 WP_001029580.1.39322 WP_001029580.1.39336 WP_001029580.1.39337 WP_001029580.1.3934 WP_001029580.1.39343 WP_001029580.1.39357 WP_001029580.1.39374 WP_001029580.1.39387 WP_001029580.1.3939 WP_001029580.1.39394 WP_001029580.1.39412 WP_001029580.1.39421 WP_001029580.1.39431 WP_001029580.1.39443 WP_001029580.1.39453 WP_001029580.1.39454 WP_001029580.1.39479 WP_001029580.1.3948 WP_001029580.1.395 WP_001029580.1.39505 WP_001029580.1.39511 WP_001029580.1.39518 WP_001029580.1.39533 WP_001029580.1.39568 WP_001029580.1.39569 WP_001029580.1.39570 WP_001029580.1.39585 WP_001029580.1.39591 WP_001029580.1.39596 WP_001029580.1.39597 WP_001029580.1.39648 WP_001029580.1.3966 WP_001029580.1.39663 WP_001029580.1.39710 WP_001029580.1.39719 WP_001029580.1.39731 WP_001029580.1.39736 WP_001029580.1.39754 WP_001029580.1.39793 WP_001029580.1.39813 WP_001029580.1.39824 WP_001029580.1.39828 WP_001029580.1.39833 WP_001029580.1.39865 WP_001029580.1.39866 WP_001029580.1.39872 WP_001029580.1.39886 WP_001029580.1.39931 WP_001029580.1.39944 WP_001029580.1.39948 WP_001029580.1.39964 WP_001029580.1.39978 WP_001029580.1.39985 WP_001029580.1.39990 WP_001029580.1.400 WP_001029580.1.40003 WP_001029580.1.40005 WP_001029580.1.40007 WP_001029580.1.40018 WP_001029580.1.40022 WP_001029580.1.40027 WP_001029580.1.40041 WP_001029580.1.40050 WP_001029580.1.4008 WP_001029580.1.40092 WP_001029580.1.40106 WP_001029580.1.40112 WP_001029580.1.40117 WP_001029580.1.40118 WP_001029580.1.40122 WP_001029580.1.40128 WP_001029580.1.4017 WP_001029580.1.40182 WP_001029580.1.40216 WP_001029580.1.4023 WP_001029580.1.40239 WP_001029580.1.40251 WP_001029580.1.40269 WP_001029580.1.40274 WP_001029580.1.40290 WP_001029580.1.40296 WP_001029580.1.40303 WP_001029580.1.40306 WP_001029580.1.40325 WP_001029580.1.40327 WP_001029580.1.40333 WP_001029580.1.40347 WP_001029580.1.40363 WP_001029580.1.40376 WP_001029580.1.40393 WP_001029580.1.40400 WP_001029580.1.40422 WP_001029580.1.40434 WP_001029580.1.4044 WP_001029580.1.40475 WP_001029580.1.40479 WP_001029580.1.40487 WP_001029580.1.40515 WP_001029580.1.40526 WP_001029580.1.40558 WP_001029580.1.40566 WP_001029580.1.40568 WP_001029580.1.40574 WP_001029580.1.40578 WP_001029580.1.4059 WP_001029580.1.40602 WP_001029580.1.40626 WP_001029580.1.40642 WP_001029580.1.40667 WP_001029580.1.40673 WP_001029580.1.40682 WP_001029580.1.40696 WP_001029580.1.4070 WP_001029580.1.40714 WP_001029580.1.40726 WP_001029580.1.40728 WP_001029580.1.4073 WP_001029580.1.40730 WP_001029580.1.40733 WP_001029580.1.40736 WP_001029580.1.40737 WP_001029580.1.40738 WP_001029580.1.40739 WP_001029580.1.40746 WP_001029580.1.40754 WP_001029580.1.40756 WP_001029580.1.40767 WP_001029580.1.40801 WP_001029580.1.40826 WP_001029580.1.4084 WP_001029580.1.40850 WP_001029580.1.40879 WP_001029580.1.40883 WP_001029580.1.40887 WP_001029580.1.40889 WP_001029580.1.40928 WP_001029580.1.40958 WP_001029580.1.40960 WP_001029580.1.40968 WP_001029580.1.40971 WP_001029580.1.40974 WP_001029580.1.40977 WP_001029580.1.40982 WP_001029580.1.40985 WP_001029580.1.40986 WP_001029580.1.41008 WP_001029580.1.41012 WP_001029580.1.41019 WP_001029580.1.41021 WP_001029580.1.41025 WP_001029580.1.41040 WP_001029580.1.41047 WP_001029580.1.41068 WP_001029580.1.41071 WP_001029580.1.41088 WP_001029580.1.4111 WP_001029580.1.41126 WP_001029580.1.41138 WP_001029580.1.41162 WP_001029580.1.4117 WP_001029580.1.41186 WP_001029580.1.41203 WP_001029580.1.41209 WP_001029580.1.41267 WP_001029580.1.41268 WP_001029580.1.41275 WP_001029580.1.41278 WP_001029580.1.4128 WP_001029580.1.41306 WP_001029580.1.41309 WP_001029580.1.41317 WP_001029580.1.41319 WP_001029580.1.41327 WP_001029580.1.4133 WP_001029580.1.41360 WP_001029580.1.41366 WP_001029580.1.41387 WP_001029580.1.41388 WP_001029580.1.4143 WP_001029580.1.41450 WP_001029580.1.41467 WP_001029580.1.4147 WP_001029580.1.41475 WP_001029580.1.41476 WP_001029580.1.41508 WP_001029580.1.4152 WP_001029580.1.41523 WP_001029580.1.41527 WP_001029580.1.41551 WP_001029580.1.4159 WP_001029580.1.41594 WP_001029580.1.41607 WP_001029580.1.41652 WP_001029580.1.41673 WP_001029580.1.41684 WP_001029580.1.41697 WP_001029580.1.417 WP_001029580.1.41709 WP_001029580.1.41737 WP_001029580.1.41739 WP_001029580.1.41756 WP_001029580.1.41757 WP_001029580.1.41763 WP_001029580.1.41775 WP_001029580.1.41787 WP_001029580.1.41801 WP_001029580.1.41808 WP_001029580.1.41811 WP_001029580.1.41823 WP_001029580.1.41827 WP_001029580.1.41850 WP_001029580.1.41858 WP_001029580.1.41892 WP_001029580.1.41902 WP_001029580.1.41914 WP_001029580.1.41927 WP_001029580.1.41932 WP_001029580.1.41937 WP_001029580.1.41952 WP_001029580.1.41958 WP_001029580.1.41961 WP_001029580.1.41986 WP_001029580.1.4201 WP_001029580.1.42021 WP_001029580.1.42024 WP_001029580.1.42030 WP_001029580.1.42034 WP_001029580.1.42076 WP_001029580.1.42086 WP_001029580.1.42099 WP_001029580.1.42100 WP_001029580.1.42106 WP_001029580.1.42140 WP_001029580.1.42173 WP_001029580.1.42195 WP_001029580.1.42199 WP_001029580.1.42204 WP_001029580.1.42229 WP_001029580.1.42232 WP_001029580.1.42234 WP_001029580.1.42245 WP_001029580.1.42266 WP_001029580.1.42275 WP_001029580.1.42291 WP_001029580.1.4230 WP_001029580.1.42303 WP_001029580.1.42331 WP_001029580.1.42337 WP_001029580.1.42348 WP_001029580.1.42358 WP_001029580.1.4238 WP_001029580.1.42386 WP_001029580.1.424 WP_001029580.1.42437 WP_001029580.1.42450 WP_001029580.1.42470 WP_001029580.1.4249 WP_001029580.1.42500 WP_001029580.1.42515 WP_001029580.1.42528 WP_001029580.1.42536 WP_001029580.1.42538 WP_001029580.1.42546 WP_001029580.1.42566 WP_001029580.1.42611 WP_001029580.1.42625 WP_001029580.1.42642 WP_001029580.1.42654 WP_001029580.1.427 WP_001029580.1.42715 WP_001029580.1.42741 WP_001029580.1.42743 WP_001029580.1.42760 WP_001029580.1.42792 WP_001029580.1.42817 WP_001029580.1.42820 WP_001029580.1.4283 WP_001029580.1.42846 WP_001029580.1.42873 WP_001029580.1.42906 WP_001029580.1.42911 WP_001029580.1.42933 WP_001029580.1.42935 WP_001029580.1.42938 WP_001029580.1.42960 WP_001029580.1.42964 WP_001029580.1.42965 WP_001029580.1.42969 WP_001029580.1.43012 WP_001029580.1.43015 WP_001029580.1.43017 WP_001029580.1.4302 WP_001029580.1.43029 WP_001029580.1.43045 WP_001029580.1.43046 WP_001029580.1.43059 WP_001029580.1.43066 WP_001029580.1.4307 WP_001029580.1.43074 WP_001029580.1.43085 WP_001029580.1.43101 WP_001029580.1.43109 WP_001029580.1.43119 WP_001029580.1.43150 WP_001029580.1.4317 WP_001029580.1.43186 WP_001029580.1.43192 WP_001029580.1.43197 WP_001029580.1.4320 WP_001029580.1.43205 WP_001029580.1.43207 WP_001029580.1.43210 WP_001029580.1.43219 WP_001029580.1.4328 WP_001029580.1.43289 WP_001029580.1.43294 WP_001029580.1.43302 WP_001029580.1.43329 WP_001029580.1.43343 WP_001029580.1.43344 WP_001029580.1.43345 WP_001029580.1.43347 WP_001029580.1.43367 WP_001029580.1.43377 WP_001029580.1.43390 WP_001029580.1.434 WP_001029580.1.4340 WP_001029580.1.43408 WP_001029580.1.43423 WP_001029580.1.43424 WP_001029580.1.43426 WP_001029580.1.43440 WP_001029580.1.43443 WP_001029580.1.43453 WP_001029580.1.43464 WP_001029580.1.43467 WP_001029580.1.43479 WP_001029580.1.43496 WP_001029580.1.43503 WP_001029580.1.43511 WP_001029580.1.43518 WP_001029580.1.43527 WP_001029580.1.43529 WP_001029580.1.43537 WP_001029580.1.43558 WP_001029580.1.4358 WP_001029580.1.43580 WP_001029580.1.43584 WP_001029580.1.4364 WP_001029580.1.43644 WP_001029580.1.43658 WP_001029580.1.4366 WP_001029580.1.43661 WP_001029580.1.43701 WP_001029580.1.43714 WP_001029580.1.43723 WP_001029580.1.43739 WP_001029580.1.43741 WP_001029580.1.43744 WP_001029580.1.43753 WP_001029580.1.43757 WP_001029580.1.43771 WP_001029580.1.43774 WP_001029580.1.43775 WP_001029580.1.43792 WP_001029580.1.43793 WP_001029580.1.43845 WP_001029580.1.43848 WP_001029580.1.43870 WP_001029580.1.43889 WP_001029580.1.43900 WP_001029580.1.43906 WP_001029580.1.43910 WP_001029580.1.43926 WP_001029580.1.43932 WP_001029580.1.43934 WP_001029580.1.43972 WP_001029580.1.43979 WP_001029580.1.44003 WP_001029580.1.44019 WP_001029580.1.44022 WP_001029580.1.44024 WP_001029580.1.44042 WP_001029580.1.44073 WP_001029580.1.4409 WP_001029580.1.44091 WP_001029580.1.44131 WP_001029580.1.44135 WP_001029580.1.44138 WP_001029580.1.44145 WP_001029580.1.44156 WP_001029580.1.4420 WP_001029580.1.44209 WP_001029580.1.44218 WP_001029580.1.44227 WP_001029580.1.4425 WP_001029580.1.44295 WP_001029580.1.44303 WP_001029580.1.44306 WP_001029580.1.4432 WP_001029580.1.44328 WP_001029580.1.44329 WP_001029580.1.44335 WP_001029580.1.44356 WP_001029580.1.44387 WP_001029580.1.44402 WP_001029580.1.44403 WP_001029580.1.4442 WP_001029580.1.44421 WP_001029580.1.44439 WP_001029580.1.44462 WP_001029580.1.44473 WP_001029580.1.44487 WP_001029580.1.44496 WP_001029580.1.44498 WP_001029580.1.44512 WP_001029580.1.44533 WP_001029580.1.44550 WP_001029580.1.4456 WP_001029580.1.44574 WP_001029580.1.44584 WP_001029580.1.44595 WP_001029580.1.44601 WP_001029580.1.44647 WP_001029580.1.44681 WP_001029580.1.44682 WP_001029580.1.44683 WP_001029580.1.44695 WP_001029580.1.44699 WP_001029580.1.44711 WP_001029580.1.44764 WP_001029580.1.44789 WP_001029580.1.44825 WP_001029580.1.44835 WP_001029580.1.44844 WP_001029580.1.44850 WP_001029580.1.44858 WP_001029580.1.44872 WP_001029580.1.44885 WP_001029580.1.44890 WP_001029580.1.44894 WP_001029580.1.4491 WP_001029580.1.44921 WP_001029580.1.44937 WP_001029580.1.44938 WP_001029580.1.44972 WP_001029580.1.44987 WP_001029580.1.44995 WP_001029580.1.45006 WP_001029580.1.45021 WP_001029580.1.45023 WP_001029580.1.45051 WP_001029580.1.45065 WP_001029580.1.45078 WP_001029580.1.45109 WP_001029580.1.45112 WP_001029580.1.45118 WP_001029580.1.4512 WP_001029580.1.45120 WP_001029580.1.45166 WP_001029580.1.45179 WP_001029580.1.45187 WP_001029580.1.45196 WP_001029580.1.45207 WP_001029580.1.45220 WP_001029580.1.45222 WP_001029580.1.45224 WP_001029580.1.4525 WP_001029580.1.45263 WP_001029580.1.45265 WP_001029580.1.45266 WP_001029580.1.45276 WP_001029580.1.45283 WP_001029580.1.45287 WP_001029580.1.45346 WP_001029580.1.45357 WP_001029580.1.4536 WP_001029580.1.45370 WP_001029580.1.45378 WP_001029580.1.45417 WP_001029580.1.4543 WP_001029580.1.45433 WP_001029580.1.4547 WP_001029580.1.45505 WP_001029580.1.45506 WP_001029580.1.45531 WP_001029580.1.45539 WP_001029580.1.4554 WP_001029580.1.45572 WP_001029580.1.45601 WP_001029580.1.45606 WP_001029580.1.45612 WP_001029580.1.45623 WP_001029580.1.45639 WP_001029580.1.45652 WP_001029580.1.4566 WP_001029580.1.45673 WP_001029580.1.45687 WP_001029580.1.45688 WP_001029580.1.45691 WP_001029580.1.45746 WP_001029580.1.45749 WP_001029580.1.45753 WP_001029580.1.45762 WP_001029580.1.45810 WP_001029580.1.45820 WP_001029580.1.45825 WP_001029580.1.45843 WP_001029580.1.45879 WP_001029580.1.45886 WP_001029580.1.45905 WP_001029580.1.45917 WP_001029580.1.45927 WP_001029580.1.45948 WP_001029580.1.45952 WP_001029580.1.45959 WP_001029580.1.45981 WP_001029580.1.45993 WP_001029580.1.45997 WP_001029580.1.46012 WP_001029580.1.46022 WP_001029580.1.46024 WP_001029580.1.46044 WP_001029580.1.46060 WP_001029580.1.46074 WP_001029580.1.46088 WP_001029580.1.46094 WP_001029580.1.46156 WP_001029580.1.46158 WP_001029580.1.46166 WP_001029580.1.46177 WP_001029580.1.46178 WP_001029580.1.46184 WP_001029580.1.46191 WP_001029580.1.46206 WP_001029580.1.4621 WP_001029580.1.46251 WP_001029580.1.46252 WP_001029580.1.46281 WP_001029580.1.46284 WP_001029580.1.4629 WP_001029580.1.46290 WP_001029580.1.46295 WP_001029580.1.46309 WP_001029580.1.46470 WP_001029580.1.46480 WP_001029580.1.46483 WP_001029580.1.46495 WP_001029580.1.46498 WP_001029580.1.46500 WP_001029580.1.46501 WP_001029580.1.4656 WP_001029580.1.46560 WP_001029580.1.46562 WP_001029580.1.46564 WP_001029580.1.46565 WP_001029580.1.4659 WP_001029580.1.46598 WP_001029580.1.46607 WP_001029580.1.46610 WP_001029580.1.4663 WP_001029580.1.46632 WP_001029580.1.46634 WP_001029580.1.46640 WP_001029580.1.46649 WP_001029580.1.46656 WP_001029580.1.46665 WP_001029580.1.4667 WP_001029580.1.46673 WP_001029580.1.46683 WP_001029580.1.46687 WP_001029580.1.46694 WP_001029580.1.46709 WP_001029580.1.46716 WP_001029580.1.46721 WP_001029580.1.46783 WP_001029580.1.46784 WP_001029580.1.46809 WP_001029580.1.46822 WP_001029580.1.46831 WP_001029580.1.46858 WP_001029580.1.46871 WP_001029580.1.46874 WP_001029580.1.46878 WP_001029580.1.46884 WP_001029580.1.46892 WP_001029580.1.46893 WP_001029580.1.469 WP_001029580.1.46901 WP_001029580.1.46915 WP_001029580.1.46919 WP_001029580.1.46923 WP_001029580.1.46927 WP_001029580.1.46934 WP_001029580.1.46955 WP_001029580.1.46966 WP_001029580.1.47004 WP_001029580.1.47017 WP_001029580.1.47043 WP_001029580.1.47045 WP_001029580.1.47056 WP_001029580.1.4707 WP_001029580.1.47091 WP_001029580.1.47096 WP_001029580.1.47099 WP_001029580.1.47103 WP_001029580.1.47133 WP_001029580.1.47168 WP_001029580.1.47176 WP_001029580.1.47180 WP_001029580.1.47183 WP_001029580.1.47213 WP_001029580.1.47256 WP_001029580.1.47272 WP_001029580.1.47288 WP_001029580.1.47327 WP_001029580.1.47338 WP_001029580.1.47342 WP_001029580.1.47351 WP_001029580.1.47365 WP_001029580.1.47394 WP_001029580.1.47395 WP_001029580.1.47409 WP_001029580.1.47415 WP_001029580.1.47420 WP_001029580.1.47444 WP_001029580.1.47452 WP_001029580.1.47462 WP_001029580.1.47466 WP_001029580.1.47483 WP_001029580.1.47490 WP_001029580.1.47513 WP_001029580.1.47526 WP_001029580.1.47569 WP_001029580.1.47595 WP_001029580.1.47596 WP_001029580.1.47620 WP_001029580.1.47633 WP_001029580.1.47635 WP_001029580.1.47651 WP_001029580.1.47657 WP_001029580.1.4768 WP_001029580.1.47699 WP_001029580.1.47712 WP_001029580.1.47766 WP_001029580.1.47771 WP_001029580.1.47781 WP_001029580.1.47785 WP_001029580.1.478 WP_001029580.1.47806 WP_001029580.1.47819 WP_001029580.1.47824 WP_001029580.1.47833 WP_001029580.1.47853 WP_001029580.1.4789 WP_001029580.1.47890 WP_001029580.1.4790 WP_001029580.1.47905 WP_001029580.1.47923 WP_001029580.1.47973 WP_001029580.1.47987 WP_001029580.1.48037 WP_001029580.1.4804 WP_001029580.1.48043 WP_001029580.1.48060 WP_001029580.1.48089 WP_001029580.1.48112 WP_001029580.1.48118 WP_001029580.1.48122 WP_001029580.1.48137 WP_001029580.1.48148 WP_001029580.1.4817 WP_001029580.1.48171 WP_001029580.1.48181 WP_001029580.1.48213 WP_001029580.1.4822 WP_001029580.1.48232 WP_001029580.1.48257 WP_001029580.1.48309 WP_001029580.1.4832 WP_001029580.1.48339 WP_001029580.1.48349 WP_001029580.1.48384 WP_001029580.1.48387 WP_001029580.1.48395 WP_001029580.1.48420 WP_001029580.1.48422 WP_001029580.1.48447 WP_001029580.1.48468 WP_001029580.1.48489 WP_001029580.1.48503 WP_001029580.1.48504 WP_001029580.1.48511 WP_001029580.1.48520 WP_001029580.1.48533 WP_001029580.1.48582 WP_001029580.1.48594 WP_001029580.1.48595 WP_001029580.1.48604 WP_001029580.1.48613 WP_001029580.1.48614 WP_001029580.1.48619 WP_001029580.1.48625 WP_001029580.1.48627 WP_001029580.1.48669 WP_001029580.1.48698 WP_001029580.1.48718 WP_001029580.1.48730 WP_001029580.1.48731 WP_001029580.1.48739 WP_001029580.1.48753 WP_001029580.1.48762 WP_001029580.1.48767 WP_001029580.1.48780 WP_001029580.1.48796 WP_001029580.1.48799 WP_001029580.1.48800 WP_001029580.1.48804 WP_001029580.1.4882 WP_001029580.1.48828 WP_001029580.1.48867 WP_001029580.1.48890 WP_001029580.1.48892 WP_001029580.1.48922 WP_001029580.1.4894 WP_001029580.1.48944 WP_001029580.1.4895 WP_001029580.1.48964 WP_001029580.1.48986 WP_001029580.1.48998 WP_001029580.1.490 WP_001029580.1.49000 WP_001029580.1.49008 WP_001029580.1.49021 WP_001029580.1.49025 WP_001029580.1.49038 WP_001029580.1.49050 WP_001029580.1.49060 WP_001029580.1.49062 WP_001029580.1.49074 WP_001029580.1.49115 WP_001029580.1.49118 WP_001029580.1.49119 WP_001029580.1.49122 WP_001029580.1.49130 WP_001029580.1.49134 WP_001029580.1.49178 WP_001029580.1.49181 WP_001029580.1.492 WP_001029580.1.49208 WP_001029580.1.49213 WP_001029580.1.49216 WP_001029580.1.49232 WP_001029580.1.49268 WP_001029580.1.49283 WP_001029580.1.49303 WP_001029580.1.49324 WP_001029580.1.4933 WP_001029580.1.49331 WP_001029580.1.4934 WP_001029580.1.49354 WP_001029580.1.4936 WP_001029580.1.49385 WP_001029580.1.49389 WP_001029580.1.49407 WP_001029580.1.49408 WP_001029580.1.4951 WP_001029580.1.49510 WP_001029580.1.49511 WP_001029580.1.49514 WP_001029580.1.49538 WP_001029580.1.49540 WP_001029580.1.4957 WP_001029580.1.49571 WP_001029580.1.49587 WP_001029580.1.49597 WP_001029580.1.4960 WP_001029580.1.49600 WP_001029580.1.49601 WP_001029580.1.49628 WP_001029580.1.49636 WP_001029580.1.49656 WP_001029580.1.49692 WP_001029580.1.49752 WP_001029580.1.49759 WP_001029580.1.49765 WP_001029580.1.49776 WP_001029580.1.49801 WP_001029580.1.49840 WP_001029580.1.49841 WP_001029580.1.49845 WP_001029580.1.49873 WP_001029580.1.49874 WP_001029580.1.49881 WP_001029580.1.49889 WP_001029580.1.49901 WP_001029580.1.49904 WP_001029580.1.49909 WP_001029580.1.49955 WP_001029580.1.4996 WP_001029580.1.49971 WP_001029580.1.49973 WP_001029580.1.49975 WP_001029580.1.5000 WP_001029580.1.50000 WP_001029580.1.50001 WP_001029580.1.50005 WP_001029580.1.50016 WP_001029580.1.50031 WP_001029580.1.50034 WP_001029580.1.50048 WP_001029580.1.50059 WP_001029580.1.50070 WP_001029580.1.50083 WP_001029580.1.50089 WP_001029580.1.50094 WP_001029580.1.50105 WP_001029580.1.50107 WP_001029580.1.50108 WP_001029580.1.50120 WP_001029580.1.50129 WP_001029580.1.50134 WP_001029580.1.50139 WP_001029580.1.50143 WP_001029580.1.5015 WP_001029580.1.50151 WP_001029580.1.50168 WP_001029580.1.50169 WP_001029580.1.50184 WP_001029580.1.502 WP_001029580.1.50200 WP_001029580.1.50209 WP_001029580.1.5022 WP_001029580.1.50234 WP_001029580.1.5024 WP_001029580.1.50244 WP_001029580.1.50246 WP_001029580.1.50259 WP_001029580.1.50263 WP_001029580.1.50275 WP_001029580.1.50281 WP_001029580.1.50305 WP_001029580.1.50315 WP_001029580.1.50327 WP_001029580.1.50383 WP_001029580.1.50396 WP_001029580.1.50422 WP_001029580.1.50436 WP_001029580.1.50442 WP_001029580.1.50454 WP_001029580.1.50467 WP_001029580.1.50489 WP_001029580.1.50492 WP_001029580.1.50501 WP_001029580.1.50530 WP_001029580.1.50532 WP_001029580.1.50560 WP_001029580.1.50572 WP_001029580.1.50580 WP_001029580.1.50582 WP_001029580.1.5060 WP_001029580.1.50603 WP_001029580.1.50604 WP_001029580.1.50613 WP_001029580.1.50615 WP_001029580.1.50621 WP_001029580.1.50628 WP_001029580.1.50637 WP_001029580.1.50649 WP_001029580.1.5065 WP_001029580.1.50657 WP_001029580.1.50664 WP_001029580.1.50685 WP_001029580.1.507 WP_001029580.1.50709 WP_001029580.1.50739 WP_001029580.1.50743 WP_001029580.1.50757 WP_001029580.1.50764 WP_001029580.1.50785 WP_001029580.1.50797 WP_001029580.1.50821 WP_001029580.1.50824 WP_001029580.1.50835 WP_001029580.1.50836 WP_001029580.1.50838 WP_001029580.1.50846 WP_001029580.1.50849 WP_001029580.1.50870 WP_001029580.1.50879 WP_001029580.1.50911 WP_001029580.1.50915 WP_001029580.1.50921 WP_001029580.1.50930 WP_001029580.1.50948 WP_001029580.1.50978 WP_001029580.1.50985 WP_001029580.1.50995 WP_001029580.1.51012 WP_001029580.1.51032 WP_001029580.1.51075 WP_001029580.1.51079 WP_001029580.1.51080 WP_001029580.1.51083 WP_001029580.1.51089 WP_001029580.1.51094 WP_001029580.1.51098 WP_001029580.1.51110 WP_001029580.1.51113 WP_001029580.1.5112 WP_001029580.1.51143 WP_001029580.1.51145 WP_001029580.1.5116 WP_001029580.1.51188 WP_001029580.1.51205 WP_001029580.1.51210 WP_001029580.1.51218 WP_001029580.1.5122 WP_001029580.1.51237 WP_001029580.1.51238 WP_001029580.1.51243 WP_001029580.1.51249 WP_001029580.1.51316 WP_001029580.1.5134 WP_001029580.1.51357 WP_001029580.1.51361 WP_001029580.1.51367 WP_001029580.1.51379 WP_001029580.1.51383 WP_001029580.1.51417 WP_001029580.1.51420 WP_001029580.1.51439 WP_001029580.1.51444 WP_001029580.1.51467 WP_001029580.1.51470 WP_001029580.1.51475 WP_001029580.1.51476 WP_001029580.1.51504 WP_001029580.1.51507 WP_001029580.1.51511 WP_001029580.1.51533 WP_001029580.1.51541 WP_001029580.1.51546 WP_001029580.1.51554 WP_001029580.1.51562 WP_001029580.1.51579 WP_001029580.1.51602 WP_001029580.1.51626 WP_001029580.1.51635 WP_001029580.1.51658 WP_001029580.1.5166 WP_001029580.1.51673 WP_001029580.1.51674 WP_001029580.1.51684 WP_001029580.1.51715 WP_001029580.1.51726 WP_001029580.1.51742 WP_001029580.1.51750 WP_001029580.1.51762 WP_001029580.1.51776 WP_001029580.1.51806 WP_001029580.1.51809 WP_001029580.1.51820 WP_001029580.1.51825 WP_001029580.1.51826 WP_001029580.1.51830 WP_001029580.1.51835 WP_001029580.1.51855 WP_001029580.1.5188 WP_001029580.1.51893 WP_001029580.1.51908 WP_001029580.1.5191 WP_001029580.1.51947 WP_001029580.1.5196 WP_001029580.1.51960 WP_001029580.1.51962 WP_001029580.1.5198 WP_001029580.1.52004 WP_001029580.1.52007 WP_001029580.1.52014 WP_001029580.1.52018 WP_001029580.1.52026 WP_001029580.1.5204 WP_001029580.1.52042 WP_001029580.1.52049 WP_001029580.1.52055 WP_001029580.1.52060 WP_001029580.1.52064 WP_001029580.1.5207 WP_001029580.1.52107 WP_001029580.1.52108 WP_001029580.1.52116 WP_001029580.1.5212 WP_001029580.1.52143 WP_001029580.1.52155 WP_001029580.1.52157 WP_001029580.1.52228 WP_001029580.1.52231 WP_001029580.1.52245 WP_001029580.1.52263 WP_001029580.1.52268 WP_001029580.1.52276 WP_001029580.1.52319 WP_001029580.1.52323 WP_001029580.1.52329 WP_001029580.1.52335 WP_001029580.1.52384 WP_001029580.1.52386 WP_001029580.1.5242 WP_001029580.1.5244 WP_001029580.1.52443 WP_001029580.1.52453 WP_001029580.1.52512 WP_001029580.1.52515 WP_001029580.1.52540 WP_001029580.1.52551 WP_001029580.1.5256 WP_001029580.1.52561 WP_001029580.1.52570 WP_001029580.1.52581 WP_001029580.1.52597 WP_001029580.1.52600 WP_001029580.1.5261 WP_001029580.1.52666 WP_001029580.1.52681 WP_001029580.1.52709 WP_001029580.1.52721 WP_001029580.1.52726 WP_001029580.1.52759 WP_001029580.1.5277 WP_001029580.1.52770 WP_001029580.1.52783 WP_001029580.1.52786 WP_001029580.1.52788 WP_001029580.1.52834 WP_001029580.1.52842 WP_001029580.1.52843 WP_001029580.1.52854 WP_001029580.1.52856 WP_001029580.1.52879 WP_001029580.1.52896 WP_001029580.1.52921 WP_001029580.1.52923 WP_001029580.1.52940 WP_001029580.1.52953 WP_001029580.1.52957 WP_001029580.1.52972 WP_001029580.1.52975 WP_001029580.1.52977 WP_001029580.1.52978 WP_001029580.1.5298 WP_001029580.1.52987 WP_001029580.1.52988 WP_001029580.1.52994 WP_001029580.1.53004 WP_001029580.1.53010 WP_001029580.1.53039 WP_001029580.1.53040 WP_001029580.1.53042 WP_001029580.1.53054 WP_001029580.1.53068 WP_001029580.1.53079 WP_001029580.1.53108 WP_001029580.1.53112 WP_001029580.1.53129 WP_001029580.1.53131 WP_001029580.1.53135 WP_001029580.1.53149 WP_001029580.1.53166 WP_001029580.1.53183 WP_001029580.1.53188 WP_001029580.1.53205 WP_001029580.1.53235 WP_001029580.1.53239 WP_001029580.1.53241 WP_001029580.1.53249 WP_001029580.1.53268 WP_001029580.1.53275 WP_001029580.1.53291 WP_001029580.1.53295 WP_001029580.1.53297 WP_001029580.1.53320 WP_001029580.1.53337 WP_001029580.1.53339 WP_001029580.1.53340 WP_001029580.1.53355 WP_001029580.1.53357 WP_001029580.1.53380 WP_001029580.1.53384 WP_001029580.1.53395 WP_001029580.1.53404 WP_001029580.1.53405 WP_001029580.1.53420 WP_001029580.1.53429 WP_001029580.1.53430 WP_001029580.1.53440 WP_001029580.1.53449 WP_001029580.1.53476 WP_001029580.1.5348 WP_001029580.1.53499 WP_001029580.1.53524 WP_001029580.1.53547 WP_001029580.1.53581 WP_001029580.1.53596 WP_001029580.1.53600 WP_001029580.1.5361 WP_001029580.1.53611 WP_001029580.1.53612 WP_001029580.1.53619 WP_001029580.1.53622 WP_001029580.1.53633 WP_001029580.1.5364 WP_001029580.1.53640 WP_001029580.1.53652 WP_001029580.1.53660 WP_001029580.1.53673 WP_001029580.1.53677 WP_001029580.1.53684 WP_001029580.1.53699 WP_001029580.1.53735 WP_001029580.1.53744 WP_001029580.1.53756 WP_001029580.1.53761 WP_001029580.1.5377 WP_001029580.1.53773 WP_001029580.1.53785 WP_001029580.1.53789 WP_001029580.1.53797 WP_001029580.1.53798 WP_001029580.1.53820 WP_001029580.1.5385 WP_001029580.1.53871 WP_001029580.1.53891 WP_001029580.1.53929 WP_001029580.1.53950 WP_001029580.1.53957 WP_001029580.1.54001 WP_001029580.1.54009 WP_001029580.1.54020 WP_001029580.1.54021 WP_001029580.1.54027 WP_001029580.1.5405 WP_001029580.1.54050 WP_001029580.1.54064 WP_001029580.1.54066 WP_001029580.1.54069 WP_001029580.1.5411 WP_001029580.1.54110 WP_001029580.1.54130 WP_001029580.1.54163 WP_001029580.1.5418 WP_001029580.1.54183 WP_001029580.1.54187 WP_001029580.1.5419 WP_001029580.1.54214 WP_001029580.1.54221 WP_001029580.1.54231 WP_001029580.1.5424 WP_001029580.1.543 WP_001029580.1.54303 WP_001029580.1.5431 WP_001029580.1.5432 WP_001029580.1.54337 WP_001029580.1.54345 WP_001029580.1.54349 WP_001029580.1.5435 WP_001029580.1.54372 WP_001029580.1.54374 WP_001029580.1.54376 WP_001029580.1.54401 WP_001029580.1.54402 WP_001029580.1.54412 WP_001029580.1.5442 WP_001029580.1.54424 WP_001029580.1.54433 WP_001029580.1.54457 WP_001029580.1.54458 WP_001029580.1.54473 WP_001029580.1.54483 WP_001029580.1.54501 WP_001029580.1.54515 WP_001029580.1.54529 WP_001029580.1.5453 WP_001029580.1.54549 WP_001029580.1.54559 WP_001029580.1.54563 WP_001029580.1.54570 WP_001029580.1.54576 WP_001029580.1.54582 WP_001029580.1.54610 WP_001029580.1.54631 WP_001029580.1.54650 WP_001029580.1.54658 WP_001029580.1.54680 WP_001029580.1.54697 WP_001029580.1.54738 WP_001029580.1.54762 WP_001029580.1.5477 WP_001029580.1.54793 WP_001029580.1.54796 WP_001029580.1.54805 WP_001029580.1.54810 WP_001029580.1.54813 WP_001029580.1.54840 WP_001029580.1.54848 WP_001029580.1.54862 WP_001029580.1.54872 WP_001029580.1.54894 WP_001029580.1.54907 WP_001029580.1.54922 WP_001029580.1.54932 WP_001029580.1.54938 WP_001029580.1.5495 WP_001029580.1.54960 WP_001029580.1.54971 WP_001029580.1.54997 WP_001029580.1.550 WP_001029580.1.55035 WP_001029580.1.55039 WP_001029580.1.5504 WP_001029580.1.55053 WP_001029580.1.55066 WP_001029580.1.55071 WP_001029580.1.55078 WP_001029580.1.55079 WP_001029580.1.55087 WP_001029580.1.55091 WP_001029580.1.55093 WP_001029580.1.55107 WP_001029580.1.55110 WP_001029580.1.55120 WP_001029580.1.55143 WP_001029580.1.55148 WP_001029580.1.5515 WP_001029580.1.55207 WP_001029580.1.55211 WP_001029580.1.55217 WP_001029580.1.55244 WP_001029580.1.55256 WP_001029580.1.55259 WP_001029580.1.55262 WP_001029580.1.55277 WP_001029580.1.5528 WP_001029580.1.55281 WP_001029580.1.55292 WP_001029580.1.55298 WP_001029580.1.55299 WP_001029580.1.55312 WP_001029580.1.55329 WP_001029580.1.55331 WP_001029580.1.55332 WP_001029580.1.55337 WP_001029580.1.55360 WP_001029580.1.55362 WP_001029580.1.5537 WP_001029580.1.55377 WP_001029580.1.55385 WP_001029580.1.55388 WP_001029580.1.55395 WP_001029580.1.55409 WP_001029580.1.55411 WP_001029580.1.55426 WP_001029580.1.55432 WP_001029580.1.55438 WP_001029580.1.55474 WP_001029580.1.55479 WP_001029580.1.55499 WP_001029580.1.55502 WP_001029580.1.55519 WP_001029580.1.55523 WP_001029580.1.55524 WP_001029580.1.55525 WP_001029580.1.55531 WP_001029580.1.55532 WP_001029580.1.55534 WP_001029580.1.55561 WP_001029580.1.55566 WP_001029580.1.55584 WP_001029580.1.55587 WP_001029580.1.55589 WP_001029580.1.55654 WP_001029580.1.55677 WP_001029580.1.5568 WP_001029580.1.55685 WP_001029580.1.55708 WP_001029580.1.55711 WP_001029580.1.55716 WP_001029580.1.55722 WP_001029580.1.55726 WP_001029580.1.55733 WP_001029580.1.55736 WP_001029580.1.55756 WP_001029580.1.55761 WP_001029580.1.55763 WP_001029580.1.5578 WP_001029580.1.55810 WP_001029580.1.55816 WP_001029580.1.55823 WP_001029580.1.55836 WP_001029580.1.5586 WP_001029580.1.55861 WP_001029580.1.55876 WP_001029580.1.55879 WP_001029580.1.55889 WP_001029580.1.55906 WP_001029580.1.55918 WP_001029580.1.55947 WP_001029580.1.55969 WP_001029580.1.55978 WP_001029580.1.55980 WP_001029580.1.5599 WP_001029580.1.560 WP_001029580.1.56022 WP_001029580.1.56023 WP_001029580.1.56041 WP_001029580.1.56054 WP_001029580.1.56062 WP_001029580.1.56112 WP_001029580.1.56124 WP_001029580.1.56136 WP_001029580.1.56155 WP_001029580.1.56185 WP_001029580.1.56250 WP_001029580.1.56251 WP_001029580.1.56257 WP_001029580.1.56266 WP_001029580.1.56276 WP_001029580.1.56283 WP_001029580.1.56294 WP_001029580.1.56300 WP_001029580.1.56316 WP_001029580.1.56319 WP_001029580.1.56326 WP_001029580.1.56378 WP_001029580.1.56382 WP_001029580.1.56408 WP_001029580.1.56427 WP_001029580.1.56461 WP_001029580.1.56462 WP_001029580.1.56472 WP_001029580.1.56476 WP_001029580.1.56477 WP_001029580.1.56505 WP_001029580.1.56518 WP_001029580.1.56519 WP_001029580.1.5652 WP_001029580.1.56546 WP_001029580.1.56568 WP_001029580.1.56581 WP_001029580.1.56607 WP_001029580.1.56610 WP_001029580.1.56617 WP_001029580.1.56622 WP_001029580.1.56624 WP_001029580.1.5663 WP_001029580.1.56657 WP_001029580.1.56667 WP_001029580.1.56676 WP_001029580.1.56678 WP_001029580.1.56734 WP_001029580.1.56739 WP_001029580.1.56746 WP_001029580.1.56749 WP_001029580.1.56756 WP_001029580.1.56774 WP_001029580.1.56775 WP_001029580.1.56790 WP_001029580.1.56805 WP_001029580.1.56867 WP_001029580.1.56881 WP_001029580.1.56884 WP_001029580.1.56902 WP_001029580.1.56913 WP_001029580.1.56940 WP_001029580.1.56958 WP_001029580.1.56989 WP_001029580.1.57001 WP_001029580.1.57004 WP_001029580.1.57009 WP_001029580.1.57013 WP_001029580.1.57017 WP_001029580.1.57037 WP_001029580.1.57040 WP_001029580.1.57044 WP_001029580.1.5708 WP_001029580.1.57089 WP_001029580.1.5709 WP_001029580.1.5710 WP_001029580.1.57103 WP_001029580.1.57118 WP_001029580.1.57119 WP_001029580.1.57127 WP_001029580.1.57176 WP_001029580.1.57192 WP_001029580.1.57194 WP_001029580.1.57218 WP_001029580.1.57219 WP_001029580.1.57235 WP_001029580.1.57274 WP_001029580.1.57279 WP_001029580.1.57292 WP_001029580.1.57303 WP_001029580.1.57334 WP_001029580.1.57366 WP_001029580.1.57382 WP_001029580.1.57384 WP_001029580.1.57394 WP_001029580.1.5741 WP_001029580.1.57419 WP_001029580.1.57428 WP_001029580.1.57442 WP_001029580.1.57446 WP_001029580.1.57472 WP_001029580.1.57490 WP_001029580.1.57503 WP_001029580.1.57508 WP_001029580.1.57516 WP_001029580.1.57530 WP_001029580.1.5757 WP_001029580.1.57583 WP_001029580.1.57587 WP_001029580.1.57611 WP_001029580.1.57615 WP_001029580.1.57620 WP_001029580.1.57647 WP_001029580.1.57668 WP_001029580.1.57677 WP_001029580.1.57687 WP_001029580.1.57691 WP_001029580.1.57712 WP_001029580.1.57725 WP_001029580.1.57726 WP_001029580.1.57743 WP_001029580.1.57750 WP_001029580.1.57753 WP_001029580.1.57760 WP_001029580.1.57777 WP_001029580.1.57787 WP_001029580.1.57789 WP_001029580.1.5779 WP_001029580.1.57816 WP_001029580.1.57822 WP_001029580.1.57866 WP_001029580.1.57867 WP_001029580.1.57876 WP_001029580.1.57882 WP_001029580.1.57892 WP_001029580.1.57896 WP_001029580.1.57897 WP_001029580.1.57917 WP_001029580.1.57922 WP_001029580.1.5793 WP_001029580.1.57949 WP_001029580.1.57977 WP_001029580.1.57985 WP_001029580.1.5800 WP_001029580.1.58011 WP_001029580.1.58013 WP_001029580.1.58020 WP_001029580.1.58021 WP_001029580.1.5803 WP_001029580.1.58032 WP_001029580.1.58034 WP_001029580.1.58036 WP_001029580.1.58039 WP_001029580.1.58063 WP_001029580.1.58070 WP_001029580.1.58076 WP_001029580.1.5808 WP_001029580.1.58095 WP_001029580.1.58124 WP_001029580.1.58156 WP_001029580.1.58171 WP_001029580.1.58181 WP_001029580.1.58189 WP_001029580.1.5819 WP_001029580.1.58196 WP_001029580.1.58197 WP_001029580.1.58211 WP_001029580.1.58217 WP_001029580.1.58225 WP_001029580.1.58227 WP_001029580.1.58243 WP_001029580.1.58264 WP_001029580.1.58268 WP_001029580.1.58296 WP_001029580.1.58322 WP_001029580.1.58331 WP_001029580.1.58333 WP_001029580.1.58342 WP_001029580.1.58344 WP_001029580.1.58348 WP_001029580.1.5835 WP_001029580.1.58361 WP_001029580.1.58376 WP_001029580.1.58378 WP_001029580.1.58402 WP_001029580.1.58434 WP_001029580.1.58437 WP_001029580.1.58452 WP_001029580.1.58458 WP_001029580.1.58480 WP_001029580.1.58483 WP_001029580.1.58492 WP_001029580.1.58519 WP_001029580.1.58522 WP_001029580.1.58553 WP_001029580.1.58554 WP_001029580.1.58563 WP_001029580.1.58574 WP_001029580.1.58591 WP_001029580.1.58595 WP_001029580.1.58607 WP_001029580.1.58613 WP_001029580.1.58615 WP_001029580.1.58642 WP_001029580.1.58645 WP_001029580.1.58646 WP_001029580.1.58653 WP_001029580.1.58670 WP_001029580.1.58679 WP_001029580.1.58684 WP_001029580.1.58697 WP_001029580.1.58700 WP_001029580.1.58717 WP_001029580.1.58738 WP_001029580.1.58761 WP_001029580.1.58762 WP_001029580.1.58811 WP_001029580.1.58825 WP_001029580.1.58829 WP_001029580.1.58843 WP_001029580.1.58854 WP_001029580.1.5887 WP_001029580.1.58877 WP_001029580.1.58905 WP_001029580.1.5892 WP_001029580.1.58948 WP_001029580.1.58959 WP_001029580.1.59001 WP_001029580.1.59007 WP_001029580.1.59018 WP_001029580.1.59028 WP_001029580.1.59033 WP_001029580.1.59065 WP_001029580.1.59066 WP_001029580.1.59081 WP_001029580.1.59109 WP_001029580.1.59117 WP_001029580.1.59137 WP_001029580.1.59141 WP_001029580.1.59160 WP_001029580.1.59198 WP_001029580.1.59201 WP_001029580.1.59208 WP_001029580.1.5921 WP_001029580.1.59215 WP_001029580.1.59229 WP_001029580.1.59235 WP_001029580.1.59242 WP_001029580.1.59257 WP_001029580.1.59307 WP_001029580.1.59308 WP_001029580.1.59356 WP_001029580.1.59361 WP_001029580.1.59365 WP_001029580.1.59367 WP_001029580.1.59370 WP_001029580.1.59382 WP_001029580.1.5939 WP_001029580.1.5941 WP_001029580.1.59424 WP_001029580.1.59435 WP_001029580.1.59437 WP_001029580.1.59442 WP_001029580.1.59468 WP_001029580.1.59482 WP_001029580.1.59497 WP_001029580.1.59514 WP_001029580.1.59527 WP_001029580.1.59532 WP_001029580.1.59534 WP_001029580.1.59552 WP_001029580.1.59589 WP_001029580.1.59606 WP_001029580.1.59607 WP_001029580.1.59608 WP_001029580.1.59637 WP_001029580.1.5964 WP_001029580.1.59666 WP_001029580.1.59676 WP_001029580.1.59678 WP_001029580.1.59700 WP_001029580.1.59718 WP_001029580.1.59721 WP_001029580.1.59740 WP_001029580.1.5976 WP_001029580.1.59766 WP_001029580.1.59774 WP_001029580.1.59785 WP_001029580.1.59859 WP_001029580.1.59867 WP_001029580.1.59883 WP_001029580.1.59884 WP_001029580.1.59895 WP_001029580.1.59903 WP_001029580.1.59913 WP_001029580.1.59918 WP_001029580.1.59935 WP_001029580.1.59938 WP_001029580.1.59951 WP_001029580.1.6001 WP_001029580.1.60014 WP_001029580.1.60032 WP_001029580.1.60064 WP_001029580.1.60073 WP_001029580.1.60078 WP_001029580.1.60083 WP_001029580.1.60105 WP_001029580.1.60148 WP_001029580.1.60174 WP_001029580.1.60177 WP_001029580.1.60180 WP_001029580.1.60188 WP_001029580.1.60204 WP_001029580.1.60210 WP_001029580.1.60242 WP_001029580.1.60248 WP_001029580.1.60256 WP_001029580.1.60281 WP_001029580.1.60298 WP_001029580.1.60303 WP_001029580.1.60309 WP_001029580.1.60326 WP_001029580.1.60384 WP_001029580.1.60388 WP_001029580.1.60391 WP_001029580.1.60420 WP_001029580.1.60423 WP_001029580.1.60438 WP_001029580.1.60450 WP_001029580.1.6046 WP_001029580.1.60485 WP_001029580.1.60513 WP_001029580.1.60521 WP_001029580.1.60529 WP_001029580.1.60532 WP_001029580.1.60541 WP_001029580.1.60574 WP_001029580.1.60590 WP_001029580.1.60592 WP_001029580.1.60596 WP_001029580.1.60615 WP_001029580.1.60618 WP_001029580.1.60621 WP_001029580.1.6063 WP_001029580.1.60642 WP_001029580.1.60645 WP_001029580.1.60646 WP_001029580.1.60656 WP_001029580.1.60670 WP_001029580.1.60693 WP_001029580.1.60714 WP_001029580.1.60723 WP_001029580.1.60731 WP_001029580.1.60737 WP_001029580.1.60749 WP_001029580.1.60755 WP_001029580.1.60756 WP_001029580.1.6079 WP_001029580.1.60799 WP_001029580.1.6081 WP_001029580.1.60812 WP_001029580.1.60815 WP_001029580.1.60867 WP_001029580.1.6087 WP_001029580.1.6088 WP_001029580.1.60886 WP_001029580.1.60911 WP_001029580.1.6092 WP_001029580.1.60924 WP_001029580.1.60961 WP_001029580.1.60973 WP_001029580.1.60977 WP_001029580.1.60985 WP_001029580.1.60996 WP_001029580.1.61007 WP_001029580.1.61021 WP_001029580.1.61028 WP_001029580.1.61043 WP_001029580.1.61050 WP_001029580.1.61088 WP_001029580.1.61151 WP_001029580.1.61155 WP_001029580.1.61159 WP_001029580.1.61160 WP_001029580.1.61164 WP_001029580.1.61182 WP_001029580.1.61194 WP_001029580.1.61208 WP_001029580.1.61214 WP_001029580.1.61217 WP_001029580.1.61220 WP_001029580.1.61226 WP_001029580.1.61236 WP_001029580.1.61250 WP_001029580.1.61254 WP_001029580.1.61278 WP_001029580.1.6128 WP_001029580.1.61300 WP_001029580.1.61301 WP_001029580.1.61302 WP_001029580.1.61307 WP_001029580.1.61365 WP_001029580.1.6137 WP_001029580.1.61372 WP_001029580.1.61386 WP_001029580.1.61396 WP_001029580.1.6140 WP_001029580.1.61404 WP_001029580.1.61405 WP_001029580.1.61444 WP_001029580.1.61451 WP_001029580.1.61489 WP_001029580.1.61495 WP_001029580.1.61499 WP_001029580.1.61506 WP_001029580.1.61513 WP_001029580.1.61514 WP_001029580.1.61541 WP_001029580.1.61546 WP_001029580.1.61548 WP_001029580.1.61550 WP_001029580.1.61560 WP_001029580.1.61568 WP_001029580.1.61605 WP_001029580.1.61606 WP_001029580.1.61611 WP_001029580.1.61627 WP_001029580.1.61632 WP_001029580.1.61651 WP_001029580.1.61675 WP_001029580.1.61686 WP_001029580.1.61731 WP_001029580.1.61733 WP_001029580.1.6174 WP_001029580.1.61765 WP_001029580.1.6177 WP_001029580.1.61785 WP_001029580.1.61801 WP_001029580.1.61807 WP_001029580.1.6183 WP_001029580.1.61837 WP_001029580.1.61839 WP_001029580.1.61845 WP_001029580.1.61848 WP_001029580.1.61863 WP_001029580.1.61882 WP_001029580.1.61896 WP_001029580.1.61912 WP_001029580.1.6192 WP_001029580.1.61954 WP_001029580.1.61959 WP_001029580.1.61992 WP_001029580.1.62001 WP_001029580.1.62006 WP_001029580.1.62022 WP_001029580.1.62039 WP_001029580.1.62062 WP_001029580.1.6207 WP_001029580.1.62114 WP_001029580.1.62118 WP_001029580.1.62129 WP_001029580.1.62134 WP_001029580.1.62137 WP_001029580.1.62145 WP_001029580.1.62151 WP_001029580.1.62161 WP_001029580.1.62167 WP_001029580.1.62173 WP_001029580.1.62178 WP_001029580.1.62190 WP_001029580.1.62197 WP_001029580.1.62220 WP_001029580.1.62235 WP_001029580.1.6226 WP_001029580.1.62283 WP_001029580.1.62293 WP_001029580.1.62315 WP_001029580.1.62316 WP_001029580.1.6235 WP_001029580.1.62356 WP_001029580.1.62366 WP_001029580.1.62390 WP_001029580.1.62391 WP_001029580.1.62394 WP_001029580.1.62397 WP_001029580.1.62417 WP_001029580.1.62420 WP_001029580.1.62421 WP_001029580.1.62432 WP_001029580.1.62434 WP_001029580.1.6244 WP_001029580.1.62444 WP_001029580.1.62445 WP_001029580.1.62465 WP_001029580.1.62518 WP_001029580.1.62521 WP_001029580.1.62524 WP_001029580.1.62532 WP_001029580.1.62540 WP_001029580.1.62546 WP_001029580.1.62558 WP_001029580.1.62559 WP_001029580.1.62566 WP_001029580.1.6258 WP_001029580.1.62581 WP_001029580.1.62585 WP_001029580.1.62600 WP_001029580.1.62607 WP_001029580.1.62613 WP_001029580.1.62615 WP_001029580.1.62638 WP_001029580.1.62643 WP_001029580.1.62667 WP_001029580.1.62670 WP_001029580.1.62775 WP_001029580.1.62777 WP_001029580.1.62779 WP_001029580.1.6279 WP_001029580.1.62793 WP_001029580.1.62799 WP_001029580.1.62803 WP_001029580.1.62814 WP_001029580.1.62821 WP_001029580.1.62833 WP_001029580.1.62836 WP_001029580.1.62862 WP_001029580.1.62867 WP_001029580.1.6288 WP_001029580.1.62889 WP_001029580.1.62900 WP_001029580.1.62921 WP_001029580.1.62944 WP_001029580.1.62987 WP_001029580.1.62994 WP_001029580.1.63029 WP_001029580.1.63033 WP_001029580.1.63034 WP_001029580.1.6306 WP_001029580.1.63067 WP_001029580.1.63075 WP_001029580.1.63077 WP_001029580.1.63093 WP_001029580.1.63125 WP_001029580.1.63128 WP_001029580.1.63149 WP_001029580.1.63156 WP_001029580.1.6316 WP_001029580.1.63165 WP_001029580.1.63191 WP_001029580.1.63214 WP_001029580.1.63225 WP_001029580.1.63230 WP_001029580.1.63235 WP_001029580.1.63238 WP_001029580.1.6324 WP_001029580.1.63311 WP_001029580.1.63328 WP_001029580.1.63329 WP_001029580.1.63375 WP_001029580.1.6341 WP_001029580.1.63425 WP_001029580.1.63430 WP_001029580.1.63442 WP_001029580.1.63468 WP_001029580.1.63473 WP_001029580.1.63503 WP_001029580.1.63506 WP_001029580.1.63543 WP_001029580.1.63587 WP_001029580.1.63621 WP_001029580.1.63675 WP_001029580.1.63724 WP_001029580.1.63741 WP_001029580.1.63753 WP_001029580.1.63756 WP_001029580.1.63761 WP_001029580.1.63762 WP_001029580.1.63767 WP_001029580.1.63788 WP_001029580.1.63792 WP_001029580.1.6382 WP_001029580.1.63846 WP_001029580.1.63882 WP_001029580.1.63891 WP_001029580.1.63893 WP_001029580.1.63908 WP_001029580.1.63919 WP_001029580.1.63920 WP_001029580.1.63927 WP_001029580.1.6393 WP_001029580.1.63931 WP_001029580.1.63935 WP_001029580.1.63936 WP_001029580.1.63938 WP_001029580.1.63943 WP_001029580.1.63971 WP_001029580.1.63988 WP_001029580.1.64006 WP_001029580.1.64055 WP_001029580.1.64067 WP_001029580.1.64090 WP_001029580.1.6410 WP_001029580.1.64113 WP_001029580.1.64126 WP_001029580.1.64132 WP_001029580.1.64135 WP_001029580.1.6414 WP_001029580.1.64172 WP_001029580.1.64184 WP_001029580.1.64203 WP_001029580.1.64224 WP_001029580.1.64225 WP_001029580.1.64245 WP_001029580.1.64246 WP_001029580.1.64255 WP_001029580.1.64262 WP_001029580.1.64269 WP_001029580.1.64313 WP_001029580.1.64316 WP_001029580.1.64320 WP_001029580.1.64322 WP_001029580.1.64338 WP_001029580.1.64342 WP_001029580.1.64359 WP_001029580.1.64373 WP_001029580.1.64399 WP_001029580.1.64401 WP_001029580.1.64416 WP_001029580.1.64423 WP_001029580.1.64449 WP_001029580.1.64464 WP_001029580.1.6447 WP_001029580.1.64481 WP_001029580.1.64490 WP_001029580.1.64496 WP_001029580.1.64518 WP_001029580.1.64572 WP_001029580.1.64576 WP_001029580.1.64653 WP_001029580.1.6467 WP_001029580.1.64679 WP_001029580.1.64696 WP_001029580.1.64698 WP_001029580.1.6470 WP_001029580.1.64700 WP_001029580.1.64719 WP_001029580.1.64723 WP_001029580.1.64725 WP_001029580.1.64728 WP_001029580.1.64733 WP_001029580.1.64739 WP_001029580.1.6474 WP_001029580.1.64750 WP_001029580.1.64756 WP_001029580.1.64778 WP_001029580.1.6478 WP_001029580.1.64782 WP_001029580.1.64785 WP_001029580.1.64815 WP_001029580.1.64816 WP_001029580.1.64824 WP_001029580.1.64837 WP_001029580.1.64839 WP_001029580.1.6485 WP_001029580.1.64851 WP_001029580.1.64855 WP_001029580.1.64857 WP_001029580.1.64867 WP_001029580.1.64871 WP_001029580.1.64876 WP_001029580.1.64882 WP_001029580.1.64890 WP_001029580.1.649 WP_001029580.1.64906 WP_001029580.1.6491 WP_001029580.1.64917 WP_001029580.1.64923 WP_001029580.1.64925 WP_001029580.1.64931 WP_001029580.1.6495 WP_001029580.1.64960 WP_001029580.1.6498 WP_001029580.1.65031 WP_001029580.1.6505 WP_001029580.1.65062 WP_001029580.1.65063 WP_001029580.1.65087 WP_001029580.1.65091 WP_001029580.1.65107 WP_001029580.1.65119 WP_001029580.1.65126 WP_001029580.1.65133 WP_001029580.1.6515 WP_001029580.1.65232 WP_001029580.1.65265 WP_001029580.1.65268 WP_001029580.1.65277 WP_001029580.1.6529 WP_001029580.1.65307 WP_001029580.1.65318 WP_001029580.1.65319 WP_001029580.1.6532 WP_001029580.1.65331 WP_001029580.1.65336 WP_001029580.1.65339 WP_001029580.1.65344 WP_001029580.1.65352 WP_001029580.1.65362 WP_001029580.1.65371 WP_001029580.1.6538 WP_001029580.1.65380 WP_001029580.1.65396 WP_001029580.1.65418 WP_001029580.1.65431 WP_001029580.1.65442 WP_001029580.1.65476 WP_001029580.1.65485 WP_001029580.1.65489 WP_001029580.1.65492 WP_001029580.1.65523 WP_001029580.1.65536 WP_001029580.1.65537 WP_001029580.1.65542 WP_001029580.1.65568 WP_001029580.1.65574 WP_001029580.1.65577 WP_001029580.1.65587 WP_001029580.1.65607 WP_001029580.1.65614 WP_001029580.1.65641 WP_001029580.1.65657 WP_001029580.1.65690 WP_001029580.1.65702 WP_001029580.1.65709 WP_001029580.1.65721 WP_001029580.1.65722 WP_001029580.1.65743 WP_001029580.1.65748 WP_001029580.1.6577 WP_001029580.1.65773 WP_001029580.1.65789 WP_001029580.1.65792 WP_001029580.1.65797 WP_001029580.1.65799 WP_001029580.1.658 WP_001029580.1.6580 WP_001029580.1.65806 WP_001029580.1.65814 WP_001029580.1.65829 WP_001029580.1.65853 WP_001029580.1.65859 WP_001029580.1.65887 WP_001029580.1.65896 WP_001029580.1.65897 WP_001029580.1.65916 WP_001029580.1.65920 WP_001029580.1.65936 WP_001029580.1.65941 WP_001029580.1.65944 WP_001029580.1.65960 WP_001029580.1.65971 WP_001029580.1.65982 WP_001029580.1.66003 WP_001029580.1.66006 WP_001029580.1.66046 WP_001029580.1.66053 WP_001029580.1.66087 WP_001029580.1.66099 WP_001029580.1.66115 WP_001029580.1.66132 WP_001029580.1.66135 WP_001029580.1.66139 WP_001029580.1.66146 WP_001029580.1.66164 WP_001029580.1.66166 WP_001029580.1.66191 WP_001029580.1.66195 WP_001029580.1.66205 WP_001029580.1.66207 WP_001029580.1.6621 WP_001029580.1.66230 WP_001029580.1.6625 WP_001029580.1.66274 WP_001029580.1.66278 WP_001029580.1.663 WP_001029580.1.66309 WP_001029580.1.66333 WP_001029580.1.66356 WP_001029580.1.66381 WP_001029580.1.66399 WP_001029580.1.66411 WP_001029580.1.66468 WP_001029580.1.66470 WP_001029580.1.66477 WP_001029580.1.66490 WP_001029580.1.66497 WP_001029580.1.66500 WP_001029580.1.66536 WP_001029580.1.66569 WP_001029580.1.66571 WP_001029580.1.66586 WP_001029580.1.66595 WP_001029580.1.66620 WP_001029580.1.66637 WP_001029580.1.66640 WP_001029580.1.66653 WP_001029580.1.66654 WP_001029580.1.66674 WP_001029580.1.66683 WP_001029580.1.66685 WP_001029580.1.66687 WP_001029580.1.66688 WP_001029580.1.66694 WP_001029580.1.66734 WP_001029580.1.66745 WP_001029580.1.66757 WP_001029580.1.66764 WP_001029580.1.66781 WP_001029580.1.6679 WP_001029580.1.66797 WP_001029580.1.66813 WP_001029580.1.66829 WP_001029580.1.66835 WP_001029580.1.66852 WP_001029580.1.66861 WP_001029580.1.66881 WP_001029580.1.66894 WP_001029580.1.669 WP_001029580.1.66914 WP_001029580.1.66917 WP_001029580.1.6695 WP_001029580.1.66956 WP_001029580.1.66964 WP_001029580.1.66966 WP_001029580.1.66971 WP_001029580.1.66973 WP_001029580.1.66983 WP_001029580.1.67039 WP_001029580.1.67056 WP_001029580.1.67076 WP_001029580.1.67084 WP_001029580.1.67096 WP_001029580.1.67114 WP_001029580.1.67115 WP_001029580.1.67121 WP_001029580.1.67148 WP_001029580.1.67151 WP_001029580.1.67169 WP_001029580.1.67196 WP_001029580.1.67206 WP_001029580.1.67215 WP_001029580.1.67222 WP_001029580.1.67274 WP_001029580.1.673 WP_001029580.1.67302 WP_001029580.1.67304 WP_001029580.1.67327 WP_001029580.1.67349 WP_001029580.1.67353 WP_001029580.1.67358 WP_001029580.1.67398 WP_001029580.1.67401 WP_001029580.1.67416 WP_001029580.1.67432 WP_001029580.1.67443 WP_001029580.1.67458 WP_001029580.1.67469 WP_001029580.1.67494 WP_001029580.1.67498 WP_001029580.1.67508 WP_001029580.1.67510 WP_001029580.1.67515 WP_001029580.1.67557 WP_001029580.1.67565 WP_001029580.1.67583 WP_001029580.1.6759 WP_001029580.1.67594 WP_001029580.1.67596 WP_001029580.1.67613 WP_001029580.1.67639 WP_001029580.1.67648 WP_001029580.1.67655 WP_001029580.1.67684 WP_001029580.1.67697 WP_001029580.1.6773 WP_001029580.1.67739 WP_001029580.1.67741 WP_001029580.1.67748 WP_001029580.1.67761 WP_001029580.1.67793 WP_001029580.1.67797 WP_001029580.1.67804 WP_001029580.1.67807 WP_001029580.1.67831 WP_001029580.1.67840 WP_001029580.1.67881 WP_001029580.1.67885 WP_001029580.1.67921 WP_001029580.1.67930 WP_001029580.1.6795 WP_001029580.1.67950 WP_001029580.1.67965 WP_001029580.1.67979 WP_001029580.1.68002 WP_001029580.1.68017 WP_001029580.1.68048 WP_001029580.1.68061 WP_001029580.1.68072 WP_001029580.1.68077 WP_001029580.1.68078 WP_001029580.1.68084 WP_001029580.1.681 WP_001029580.1.6812 WP_001029580.1.68192 WP_001029580.1.6821 WP_001029580.1.68220 WP_001029580.1.68238 WP_001029580.1.68245 WP_001029580.1.6826 WP_001029580.1.68267 WP_001029580.1.68287 WP_001029580.1.68306 WP_001029580.1.68310 WP_001029580.1.68323 WP_001029580.1.68352 WP_001029580.1.68363 WP_001029580.1.68377 WP_001029580.1.68381 WP_001029580.1.68393 WP_001029580.1.68406 WP_001029580.1.68430 WP_001029580.1.68431 WP_001029580.1.68453 WP_001029580.1.68458 WP_001029580.1.68460 WP_001029580.1.68464 WP_001029580.1.68469 WP_001029580.1.68494 WP_001029580.1.68503 WP_001029580.1.68508 WP_001029580.1.68531 WP_001029580.1.68535 WP_001029580.1.68544 WP_001029580.1.68560 WP_001029580.1.68567 WP_001029580.1.68578 WP_001029580.1.68595 WP_001029580.1.68596 WP_001029580.1.68597 WP_001029580.1.68600 WP_001029580.1.68605 WP_001029580.1.68639 WP_001029580.1.68644 WP_001029580.1.68653 WP_001029580.1.68660 WP_001029580.1.68661 WP_001029580.1.68671 WP_001029580.1.68686 WP_001029580.1.68689 WP_001029580.1.68712 WP_001029580.1.68721 WP_001029580.1.68729 WP_001029580.1.68755 WP_001029580.1.68777 WP_001029580.1.68784 WP_001029580.1.68812 WP_001029580.1.68814 WP_001029580.1.68819 WP_001029580.1.68822 WP_001029580.1.68825 WP_001029580.1.68835 WP_001029580.1.68851 WP_001029580.1.68852 WP_001029580.1.68853 WP_001029580.1.68868 WP_001029580.1.68872 WP_001029580.1.6890 WP_001029580.1.68939 WP_001029580.1.6894 WP_001029580.1.68960 WP_001029580.1.68963 WP_001029580.1.68992 WP_001029580.1.69 WP_001029580.1.690 WP_001029580.1.69000 WP_001029580.1.69005 WP_001029580.1.69017 WP_001029580.1.69037 WP_001029580.1.69052 WP_001029580.1.69057 WP_001029580.1.69063 WP_001029580.1.69065 WP_001029580.1.69073 WP_001029580.1.69097 WP_001029580.1.69116 WP_001029580.1.69137 WP_001029580.1.69148 WP_001029580.1.69149 WP_001029580.1.69211 WP_001029580.1.69224 WP_001029580.1.69230 WP_001029580.1.69234 WP_001029580.1.69235 WP_001029580.1.69241 WP_001029580.1.69246 WP_001029580.1.6925 WP_001029580.1.69285 WP_001029580.1.69292 WP_001029580.1.69313 WP_001029580.1.69321 WP_001029580.1.69326 WP_001029580.1.69344 WP_001029580.1.69399 WP_001029580.1.69407 WP_001029580.1.69416 WP_001029580.1.69420 WP_001029580.1.69428 WP_001029580.1.69431 WP_001029580.1.69482 WP_001029580.1.69499 WP_001029580.1.69500 WP_001029580.1.69504 WP_001029580.1.69512 WP_001029580.1.69531 WP_001029580.1.69541 WP_001029580.1.69549 WP_001029580.1.69557 WP_001029580.1.69560 WP_001029580.1.69591 WP_001029580.1.69608 WP_001029580.1.6961 WP_001029580.1.69623 WP_001029580.1.69626 WP_001029580.1.69641 WP_001029580.1.69653 WP_001029580.1.69670 WP_001029580.1.69671 WP_001029580.1.69687 WP_001029580.1.6969 WP_001029580.1.6970 WP_001029580.1.69715 WP_001029580.1.69731 WP_001029580.1.69739 WP_001029580.1.69752 WP_001029580.1.69757 WP_001029580.1.69797 WP_001029580.1.69798 WP_001029580.1.69825 WP_001029580.1.69850 WP_001029580.1.69866 WP_001029580.1.69869 WP_001029580.1.6988 WP_001029580.1.69905 WP_001029580.1.69911 WP_001029580.1.69917 WP_001029580.1.69940 WP_001029580.1.69946 WP_001029580.1.69962 WP_001029580.1.69998 WP_001029580.1.7 WP_001029580.1.70001 WP_001029580.1.70011 WP_001029580.1.70020 WP_001029580.1.70051 WP_001029580.1.70056 WP_001029580.1.70057 WP_001029580.1.70064 WP_001029580.1.70073 WP_001029580.1.70075 WP_001029580.1.7008 WP_001029580.1.70110 WP_001029580.1.70119 WP_001029580.1.70121 WP_001029580.1.70142 WP_001029580.1.70150 WP_001029580.1.70156 WP_001029580.1.70159 WP_001029580.1.70166 WP_001029580.1.7018 WP_001029580.1.70192 WP_001029580.1.70199 WP_001029580.1.70214 WP_001029580.1.70221 WP_001029580.1.70223 WP_001029580.1.70224 WP_001029580.1.70233 WP_001029580.1.70275 WP_001029580.1.70277 WP_001029580.1.70279 WP_001029580.1.70298 WP_001029580.1.70302 WP_001029580.1.70308 WP_001029580.1.70315 WP_001029580.1.70316 WP_001029580.1.70360 WP_001029580.1.70400 WP_001029580.1.70409 WP_001029580.1.70421 WP_001029580.1.70430 WP_001029580.1.70436 WP_001029580.1.70453 WP_001029580.1.7047 WP_001029580.1.70486 WP_001029580.1.70490 WP_001029580.1.70513 WP_001029580.1.70515 WP_001029580.1.70520 WP_001029580.1.70524 WP_001029580.1.70532 WP_001029580.1.70535 WP_001029580.1.70536 WP_001029580.1.70538 WP_001029580.1.70567 WP_001029580.1.7057 WP_001029580.1.70617 WP_001029580.1.70620 WP_001029580.1.70629 WP_001029580.1.70630 WP_001029580.1.70674 WP_001029580.1.70707 WP_001029580.1.70741 WP_001029580.1.7075 WP_001029580.1.70766 WP_001029580.1.70802 WP_001029580.1.70838 WP_001029580.1.70851 WP_001029580.1.70867 WP_001029580.1.70876 WP_001029580.1.70877 WP_001029580.1.70887 WP_001029580.1.70904 WP_001029580.1.70916 WP_001029580.1.70931 WP_001029580.1.70942 WP_001029580.1.70949 WP_001029580.1.70951 WP_001029580.1.70961 WP_001029580.1.70987 WP_001029580.1.70988 WP_001029580.1.71014 WP_001029580.1.71017 WP_001029580.1.71020 WP_001029580.1.71030 WP_001029580.1.71051 WP_001029580.1.71053 WP_001029580.1.71060 WP_001029580.1.71065 WP_001029580.1.71078 WP_001029580.1.71082 WP_001029580.1.71084 WP_001029580.1.7112 WP_001029580.1.71133 WP_001029580.1.71178 WP_001029580.1.71195 WP_001029580.1.71206 WP_001029580.1.71211 WP_001029580.1.7123 WP_001029580.1.7126 WP_001029580.1.71283 WP_001029580.1.71360 WP_001029580.1.71369 WP_001029580.1.71415 WP_001029580.1.71436 WP_001029580.1.71460 WP_001029580.1.71534 WP_001029580.1.71565 WP_001029580.1.71571 WP_001029580.1.71574 WP_001029580.1.71605 WP_001029580.1.71622 WP_001029580.1.71659 WP_001029580.1.71663 WP_001029580.1.7167 WP_001029580.1.71673 WP_001029580.1.71675 WP_001029580.1.71685 WP_001029580.1.71700 WP_001029580.1.7173 WP_001029580.1.71742 WP_001029580.1.71758 WP_001029580.1.71773 WP_001029580.1.71785 WP_001029580.1.71787 WP_001029580.1.71818 WP_001029580.1.71824 WP_001029580.1.71841 WP_001029580.1.71849 WP_001029580.1.71869 WP_001029580.1.71870 WP_001029580.1.7188 WP_001029580.1.71880 WP_001029580.1.71883 WP_001029580.1.71897 WP_001029580.1.71905 WP_001029580.1.71926 WP_001029580.1.71955 WP_001029580.1.71959 WP_001029580.1.71977 WP_001029580.1.72009 WP_001029580.1.72043 WP_001029580.1.72071 WP_001029580.1.72074 WP_001029580.1.72082 WP_001029580.1.72088 WP_001029580.1.72095 WP_001029580.1.72096 WP_001029580.1.72108 WP_001029580.1.72115 WP_001029580.1.72135 WP_001029580.1.72145 WP_001029580.1.72147 WP_001029580.1.72160 WP_001029580.1.72163 WP_001029580.1.72192 WP_001029580.1.72233 WP_001029580.1.72235 WP_001029580.1.72242 WP_001029580.1.72253 WP_001029580.1.72321 WP_001029580.1.72329 WP_001029580.1.72368 WP_001029580.1.72390 WP_001029580.1.72407 WP_001029580.1.72416 WP_001029580.1.72421 WP_001029580.1.72426 WP_001029580.1.72454 WP_001029580.1.7247 WP_001029580.1.72472 WP_001029580.1.72474 WP_001029580.1.72502 WP_001029580.1.72534 WP_001029580.1.72542 WP_001029580.1.72561 WP_001029580.1.72565 WP_001029580.1.72595 WP_001029580.1.72610 WP_001029580.1.7262 WP_001029580.1.72628 WP_001029580.1.72630 WP_001029580.1.72646 WP_001029580.1.7268 WP_001029580.1.72705 WP_001029580.1.7271 WP_001029580.1.72712 WP_001029580.1.72736 WP_001029580.1.72769 WP_001029580.1.72781 WP_001029580.1.72785 WP_001029580.1.7279 WP_001029580.1.72796 WP_001029580.1.72825 WP_001029580.1.72854 WP_001029580.1.72855 WP_001029580.1.7289 WP_001029580.1.72900 WP_001029580.1.72922 WP_001029580.1.72926 WP_001029580.1.72932 WP_001029580.1.72934 WP_001029580.1.72940 WP_001029580.1.72963 WP_001029580.1.7299 WP_001029580.1.73008 WP_001029580.1.73012 WP_001029580.1.73027 WP_001029580.1.73043 WP_001029580.1.73051 WP_001029580.1.73058 WP_001029580.1.73064 WP_001029580.1.73065 WP_001029580.1.73071 WP_001029580.1.73089 WP_001029580.1.73093 WP_001029580.1.73099 WP_001029580.1.7310 WP_001029580.1.73100 WP_001029580.1.73101 WP_001029580.1.73106 WP_001029580.1.73133 WP_001029580.1.73178 WP_001029580.1.73185 WP_001029580.1.732 WP_001029580.1.73209 WP_001029580.1.73214 WP_001029580.1.73226 WP_001029580.1.73227 WP_001029580.1.73288 WP_001029580.1.73320 WP_001029580.1.73322 WP_001029580.1.73324 WP_001029580.1.73356 WP_001029580.1.73357 WP_001029580.1.73359 WP_001029580.1.73369 WP_001029580.1.73384 WP_001029580.1.73397 WP_001029580.1.73419 WP_001029580.1.73433 WP_001029580.1.73438 WP_001029580.1.73462 WP_001029580.1.7347 WP_001029580.1.73500 WP_001029580.1.73502 WP_001029580.1.73509 WP_001029580.1.7352 WP_001029580.1.73522 WP_001029580.1.73543 WP_001029580.1.73548 WP_001029580.1.73554 WP_001029580.1.73567 WP_001029580.1.73568 WP_001029580.1.7357 WP_001029580.1.73578 WP_001029580.1.73588 WP_001029580.1.7359 WP_001029580.1.73593 WP_001029580.1.73622 WP_001029580.1.73665 WP_001029580.1.73666 WP_001029580.1.73675 WP_001029580.1.73710 WP_001029580.1.73716 WP_001029580.1.73725 WP_001029580.1.73726 WP_001029580.1.73747 WP_001029580.1.73771 WP_001029580.1.73777 WP_001029580.1.73796 WP_001029580.1.73800 WP_001029580.1.73812 WP_001029580.1.73838 WP_001029580.1.73851 WP_001029580.1.73857 WP_001029580.1.73890 WP_001029580.1.73903 WP_001029580.1.73907 WP_001029580.1.73912 WP_001029580.1.73914 WP_001029580.1.73923 WP_001029580.1.73939 WP_001029580.1.7397 WP_001029580.1.73979 WP_001029580.1.73982 WP_001029580.1.74009 WP_001029580.1.74011 WP_001029580.1.74014 WP_001029580.1.74015 WP_001029580.1.74033 WP_001029580.1.74069 WP_001029580.1.74075 WP_001029580.1.7409 WP_001029580.1.74105 WP_001029580.1.74127 WP_001029580.1.74128 WP_001029580.1.74139 WP_001029580.1.7420 WP_001029580.1.74206 WP_001029580.1.74208 WP_001029580.1.74220 WP_001029580.1.74231 WP_001029580.1.74239 WP_001029580.1.74250 WP_001029580.1.74260 WP_001029580.1.74308 WP_001029580.1.7431 WP_001029580.1.74314 WP_001029580.1.74330 WP_001029580.1.74341 WP_001029580.1.74363 WP_001029580.1.74364 WP_001029580.1.74385 WP_001029580.1.74387 WP_001029580.1.74396 WP_001029580.1.74399 WP_001029580.1.74419 WP_001029580.1.74437 WP_001029580.1.74443 WP_001029580.1.74448 WP_001029580.1.74471 WP_001029580.1.7449 WP_001029580.1.74496 WP_001029580.1.74508 WP_001029580.1.74516 WP_001029580.1.74537 WP_001029580.1.74548 WP_001029580.1.74550 WP_001029580.1.74582 WP_001029580.1.74607 WP_001029580.1.74618 WP_001029580.1.74633 WP_001029580.1.7466 WP_001029580.1.7468 WP_001029580.1.74751 WP_001029580.1.74762 WP_001029580.1.74780 WP_001029580.1.74795 WP_001029580.1.74796 WP_001029580.1.74822 WP_001029580.1.74848 WP_001029580.1.7485 WP_001029580.1.74855 WP_001029580.1.74877 WP_001029580.1.7488 WP_001029580.1.74891 WP_001029580.1.74906 WP_001029580.1.74928 WP_001029580.1.74940 WP_001029580.1.74974 WP_001029580.1.75031 WP_001029580.1.75049 WP_001029580.1.75053 WP_001029580.1.75062 WP_001029580.1.75074 WP_001029580.1.75085 WP_001029580.1.75088 WP_001029580.1.75094 WP_001029580.1.75096 WP_001029580.1.75099 WP_001029580.1.75102 WP_001029580.1.75123 WP_001029580.1.75142 WP_001029580.1.75154 WP_001029580.1.75156 WP_001029580.1.75165 WP_001029580.1.7517 WP_001029580.1.75191 WP_001029580.1.75203 WP_001029580.1.75222 WP_001029580.1.75259 WP_001029580.1.7527 WP_001029580.1.75284 WP_001029580.1.75302 WP_001029580.1.75314 WP_001029580.1.75317 WP_001029580.1.75335 WP_001029580.1.75336 WP_001029580.1.75355 WP_001029580.1.75370 WP_001029580.1.75401 WP_001029580.1.75406 WP_001029580.1.75427 WP_001029580.1.75429 WP_001029580.1.75445 WP_001029580.1.75455 WP_001029580.1.75464 WP_001029580.1.75469 WP_001029580.1.7548 WP_001029580.1.75490 WP_001029580.1.75492 WP_001029580.1.75493 WP_001029580.1.75500 WP_001029580.1.75522 WP_001029580.1.75534 WP_001029580.1.7554 WP_001029580.1.75546 WP_001029580.1.75547 WP_001029580.1.75558 WP_001029580.1.75582 WP_001029580.1.75586 WP_001029580.1.75601 WP_001029580.1.75632 WP_001029580.1.75648 WP_001029580.1.75654 WP_001029580.1.75675 WP_001029580.1.75691 WP_001029580.1.75701 WP_001029580.1.75709 WP_001029580.1.75729 WP_001029580.1.7573 WP_001029580.1.75752 WP_001029580.1.75755 WP_001029580.1.75759 WP_001029580.1.75787 WP_001029580.1.75834 WP_001029580.1.75857 WP_001029580.1.75876 WP_001029580.1.75877 WP_001029580.1.75880 WP_001029580.1.75897 WP_001029580.1.75899 WP_001029580.1.75904 WP_001029580.1.75907 WP_001029580.1.7591 WP_001029580.1.75955 WP_001029580.1.75976 WP_001029580.1.75982 WP_001029580.1.75987 WP_001029580.1.75996 WP_001029580.1.760 WP_001029580.1.76003 WP_001029580.1.76017 WP_001029580.1.76018 WP_001029580.1.76041 WP_001029580.1.76051 WP_001029580.1.76068 WP_001029580.1.76080 WP_001029580.1.76093 WP_001029580.1.76161 WP_001029580.1.76165 WP_001029580.1.76166 WP_001029580.1.76195 WP_001029580.1.76220 WP_001029580.1.76233 WP_001029580.1.76249 WP_001029580.1.76251 WP_001029580.1.76263 WP_001029580.1.76264 WP_001029580.1.76265 WP_001029580.1.76285 WP_001029580.1.76289 WP_001029580.1.76293 WP_001029580.1.76303 WP_001029580.1.76344 WP_001029580.1.76357 WP_001029580.1.76375 WP_001029580.1.76377 WP_001029580.1.76409 WP_001029580.1.76429 WP_001029580.1.76439 WP_001029580.1.76440 WP_001029580.1.76453 WP_001029580.1.76454 WP_001029580.1.76458 WP_001029580.1.76492 WP_001029580.1.76499 WP_001029580.1.76517 WP_001029580.1.76530 WP_001029580.1.76557 WP_001029580.1.76564 WP_001029580.1.76567 WP_001029580.1.76570 WP_001029580.1.76577 WP_001029580.1.76591 WP_001029580.1.76594 WP_001029580.1.76614 WP_001029580.1.76649 WP_001029580.1.76650 WP_001029580.1.76667 WP_001029580.1.76675 WP_001029580.1.76720 WP_001029580.1.76722 WP_001029580.1.7673 WP_001029580.1.76731 WP_001029580.1.76761 WP_001029580.1.76764 WP_001029580.1.76777 WP_001029580.1.7678 WP_001029580.1.76780 WP_001029580.1.7679 WP_001029580.1.76830 WP_001029580.1.76837 WP_001029580.1.76850 WP_001029580.1.76857 WP_001029580.1.76862 WP_001029580.1.76865 WP_001029580.1.76868 WP_001029580.1.76874 WP_001029580.1.76892 WP_001029580.1.76927 WP_001029580.1.76942 WP_001029580.1.76972 WP_001029580.1.76980 WP_001029580.1.77 WP_001029580.1.77037 WP_001029580.1.77044 WP_001029580.1.77052 WP_001029580.1.7706 WP_001029580.1.77088 WP_001029580.1.77103 WP_001029580.1.77104 WP_001029580.1.77121 WP_001029580.1.77123 WP_001029580.1.7713 WP_001029580.1.77130 WP_001029580.1.7714 WP_001029580.1.77156 WP_001029580.1.77167 WP_001029580.1.77172 WP_001029580.1.77195 WP_001029580.1.77197 WP_001029580.1.77223 WP_001029580.1.77243 WP_001029580.1.7725 WP_001029580.1.77269 WP_001029580.1.77278 WP_001029580.1.77310 WP_001029580.1.77318 WP_001029580.1.77353 WP_001029580.1.77373 WP_001029580.1.77378 WP_001029580.1.77379 WP_001029580.1.77399 WP_001029580.1.7741 WP_001029580.1.77413 WP_001029580.1.77434 WP_001029580.1.77439 WP_001029580.1.77456 WP_001029580.1.77457 WP_001029580.1.77468 WP_001029580.1.77480 WP_001029580.1.77483 WP_001029580.1.77505 WP_001029580.1.7751 WP_001029580.1.77534 WP_001029580.1.77535 WP_001029580.1.77552 WP_001029580.1.77568 WP_001029580.1.77582 WP_001029580.1.77585 WP_001029580.1.7761 WP_001029580.1.77610 WP_001029580.1.77637 WP_001029580.1.77659 WP_001029580.1.77663 WP_001029580.1.77664 WP_001029580.1.77670 WP_001029580.1.77701 WP_001029580.1.77747 WP_001029580.1.77755 WP_001029580.1.77765 WP_001029580.1.77770 WP_001029580.1.77779 WP_001029580.1.77780 WP_001029580.1.77785 WP_001029580.1.77789 WP_001029580.1.77808 WP_001029580.1.77839 WP_001029580.1.77847 WP_001029580.1.77870 WP_001029580.1.77877 WP_001029580.1.77894 WP_001029580.1.77906 WP_001029580.1.77912 WP_001029580.1.77939 WP_001029580.1.77947 WP_001029580.1.77976 WP_001029580.1.77982 WP_001029580.1.78003 WP_001029580.1.7803 WP_001029580.1.78030 WP_001029580.1.78045 WP_001029580.1.78058 WP_001029580.1.78068 WP_001029580.1.78078 WP_001029580.1.78079 WP_001029580.1.78087 WP_001029580.1.78108 WP_001029580.1.7812 WP_001029580.1.7813 WP_001029580.1.78139 WP_001029580.1.78147 WP_001029580.1.78191 WP_001029580.1.78211 WP_001029580.1.7822 WP_001029580.1.78241 WP_001029580.1.78253 WP_001029580.1.78275 WP_001029580.1.7828 WP_001029580.1.78298 WP_001029580.1.78312 WP_001029580.1.78343 WP_001029580.1.78349 WP_001029580.1.78379 WP_001029580.1.7838 WP_001029580.1.78389 WP_001029580.1.78395 WP_001029580.1.78422 WP_001029580.1.78454 WP_001029580.1.78455 WP_001029580.1.78457 WP_001029580.1.7846 WP_001029580.1.78465 WP_001029580.1.78467 WP_001029580.1.78475 WP_001029580.1.78535 WP_001029580.1.78541 WP_001029580.1.78546 WP_001029580.1.78563 WP_001029580.1.78569 WP_001029580.1.78588 WP_001029580.1.78609 WP_001029580.1.78629 WP_001029580.1.78656 WP_001029580.1.78690 WP_001029580.1.78710 WP_001029580.1.78720 WP_001029580.1.78724 WP_001029580.1.78733 WP_001029580.1.78755 WP_001029580.1.7876 WP_001029580.1.78762 WP_001029580.1.78794 WP_001029580.1.78828 WP_001029580.1.78832 WP_001029580.1.78865 WP_001029580.1.78866 WP_001029580.1.78870 WP_001029580.1.78876 WP_001029580.1.78889 WP_001029580.1.78915 WP_001029580.1.78939 WP_001029580.1.78965 WP_001029580.1.78967 WP_001029580.1.78976 WP_001029580.1.78979 WP_001029580.1.79008 WP_001029580.1.79040 WP_001029580.1.79079 WP_001029580.1.79080 WP_001029580.1.79096 WP_001029580.1.7910 WP_001029580.1.79104 WP_001029580.1.79124 WP_001029580.1.79134 WP_001029580.1.79138 WP_001029580.1.79157 WP_001029580.1.79169 WP_001029580.1.79173 WP_001029580.1.79187 WP_001029580.1.7919 WP_001029580.1.7920 WP_001029580.1.79202 WP_001029580.1.79228 WP_001029580.1.7924 WP_001029580.1.79245 WP_001029580.1.79298 WP_001029580.1.79316 WP_001029580.1.79329 WP_001029580.1.79338 WP_001029580.1.79349 WP_001029580.1.79418 WP_001029580.1.79451 WP_001029580.1.79469 WP_001029580.1.79496 WP_001029580.1.7950 WP_001029580.1.79527 WP_001029580.1.7954 WP_001029580.1.79546 WP_001029580.1.79555 WP_001029580.1.79557 WP_001029580.1.7959 WP_001029580.1.79594 WP_001029580.1.79612 WP_001029580.1.79616 WP_001029580.1.79637 WP_001029580.1.79669 WP_001029580.1.79671 WP_001029580.1.79675 WP_001029580.1.7968 WP_001029580.1.79688 WP_001029580.1.79690 WP_001029580.1.79693 WP_001029580.1.79705 WP_001029580.1.79732 WP_001029580.1.79746 WP_001029580.1.79748 WP_001029580.1.79761 WP_001029580.1.79786 WP_001029580.1.79793 WP_001029580.1.798 WP_001029580.1.79809 WP_001029580.1.79811 WP_001029580.1.79830 WP_001029580.1.79835 WP_001029580.1.79841 WP_001029580.1.79849 WP_001029580.1.79858 WP_001029580.1.79899 WP_001029580.1.79920 WP_001029580.1.79927 WP_001029580.1.79940 WP_001029580.1.79969 WP_001029580.1.7998 WP_001029580.1.800 WP_001029580.1.80005 WP_001029580.1.80019 WP_001029580.1.8003 WP_001029580.1.80049 WP_001029580.1.80070 WP_001029580.1.80093 WP_001029580.1.80130 WP_001029580.1.80148 WP_001029580.1.8015 WP_001029580.1.80161 WP_001029580.1.80190 WP_001029580.1.80191 WP_001029580.1.80196 WP_001029580.1.80200 WP_001029580.1.80207 WP_001029580.1.80211 WP_001029580.1.80228 WP_001029580.1.80231 WP_001029580.1.80248 WP_001029580.1.80251 WP_001029580.1.80256 WP_001029580.1.80261 WP_001029580.1.80268 WP_001029580.1.80279 WP_001029580.1.80294 WP_001029580.1.80314 WP_001029580.1.8032 WP_001029580.1.80321 WP_001029580.1.80328 WP_001029580.1.80349 WP_001029580.1.80357 WP_001029580.1.80364 WP_001029580.1.80367 WP_001029580.1.80372 WP_001029580.1.80373 WP_001029580.1.80376 WP_001029580.1.8041 WP_001029580.1.80435 WP_001029580.1.80449 WP_001029580.1.80457 WP_001029580.1.80467 WP_001029580.1.80475 WP_001029580.1.8048 WP_001029580.1.80495 WP_001029580.1.80501 WP_001029580.1.80516 WP_001029580.1.80532 WP_001029580.1.80539 WP_001029580.1.80548 WP_001029580.1.80557 WP_001029580.1.80596 WP_001029580.1.80597 WP_001029580.1.80611 WP_001029580.1.80613 WP_001029580.1.80619 WP_001029580.1.80689 WP_001029580.1.80691 WP_001029580.1.80700 WP_001029580.1.80748 WP_001029580.1.80758 WP_001029580.1.80774 WP_001029580.1.80775 WP_001029580.1.80875 WP_001029580.1.80885 WP_001029580.1.80914 WP_001029580.1.80919 WP_001029580.1.80934 WP_001029580.1.80944 WP_001029580.1.80951 WP_001029580.1.80971 WP_001029580.1.80990 WP_001029580.1.80996 WP_001029580.1.8101 WP_001029580.1.81012 WP_001029580.1.81033 WP_001029580.1.81048 WP_001029580.1.8109 WP_001029580.1.81090 WP_001029580.1.81117 WP_001029580.1.81134 WP_001029580.1.81170 WP_001029580.1.81173 WP_001029580.1.81179 WP_001029580.1.81183 WP_001029580.1.81190 WP_001029580.1.81201 WP_001029580.1.81236 WP_001029580.1.81241 WP_001029580.1.81292 WP_001029580.1.81296 WP_001029580.1.81309 WP_001029580.1.81314 WP_001029580.1.81343 WP_001029580.1.8136 WP_001029580.1.81360 WP_001029580.1.81369 WP_001029580.1.81375 WP_001029580.1.81381 WP_001029580.1.81382 WP_001029580.1.81390 WP_001029580.1.81395 WP_001029580.1.81398 WP_001029580.1.81408 WP_001029580.1.81473 WP_001029580.1.81481 WP_001029580.1.81483 WP_001029580.1.81492 WP_001029580.1.81493 WP_001029580.1.81498 WP_001029580.1.815 WP_001029580.1.81500 WP_001029580.1.81530 WP_001029580.1.81534 WP_001029580.1.8154 WP_001029580.1.81545 WP_001029580.1.81550 WP_001029580.1.81573 WP_001029580.1.81585 WP_001029580.1.81586 WP_001029580.1.81587 WP_001029580.1.81616 WP_001029580.1.81628 WP_001029580.1.81630 WP_001029580.1.81639 WP_001029580.1.81663 WP_001029580.1.81703 WP_001029580.1.81707 WP_001029580.1.81716 WP_001029580.1.81724 WP_001029580.1.81729 WP_001029580.1.81745 WP_001029580.1.81769 WP_001029580.1.81775 WP_001029580.1.81781 WP_001029580.1.81801 WP_001029580.1.81807 WP_001029580.1.81817 WP_001029580.1.81857 WP_001029580.1.81890 WP_001029580.1.81894 WP_001029580.1.81929 WP_001029580.1.81959 WP_001029580.1.81962 WP_001029580.1.81967 WP_001029580.1.81984 WP_001029580.1.82005 WP_001029580.1.82016 WP_001029580.1.82020 WP_001029580.1.82029 WP_001029580.1.82042 WP_001029580.1.82049 WP_001029580.1.82051 WP_001029580.1.82052 WP_001029580.1.82085 WP_001029580.1.82094 WP_001029580.1.82140 WP_001029580.1.82159 WP_001029580.1.82189 WP_001029580.1.82191 WP_001029580.1.82195 WP_001029580.1.8221 WP_001029580.1.82212 WP_001029580.1.82213 WP_001029580.1.82255 WP_001029580.1.82279 WP_001029580.1.82284 WP_001029580.1.82297 WP_001029580.1.82298 WP_001029580.1.823 WP_001029580.1.82302 WP_001029580.1.82306 WP_001029580.1.82342 WP_001029580.1.82345 WP_001029580.1.82353 WP_001029580.1.82382 WP_001029580.1.82386 WP_001029580.1.82407 WP_001029580.1.82422 WP_001029580.1.82423 WP_001029580.1.82437 WP_001029580.1.82459 WP_001029580.1.82463 WP_001029580.1.82481 WP_001029580.1.82502 WP_001029580.1.82505 WP_001029580.1.82518 WP_001029580.1.82528 WP_001029580.1.82537 WP_001029580.1.82552 WP_001029580.1.82557 WP_001029580.1.82563 WP_001029580.1.82564 WP_001029580.1.8257 WP_001029580.1.82600 WP_001029580.1.82603 WP_001029580.1.82650 WP_001029580.1.82652 WP_001029580.1.82660 WP_001029580.1.82666 WP_001029580.1.82680 WP_001029580.1.82693 WP_001029580.1.82699 WP_001029580.1.82702 WP_001029580.1.82732 WP_001029580.1.82733 WP_001029580.1.82736 WP_001029580.1.82737 WP_001029580.1.8275 WP_001029580.1.82750 WP_001029580.1.82758 WP_001029580.1.82771 WP_001029580.1.82777 WP_001029580.1.82783 WP_001029580.1.82792 WP_001029580.1.82793 WP_001029580.1.82800 WP_001029580.1.82818 WP_001029580.1.82827 WP_001029580.1.8283 WP_001029580.1.82839 WP_001029580.1.82840 WP_001029580.1.82845 WP_001029580.1.82847 WP_001029580.1.82869 WP_001029580.1.82877 WP_001029580.1.82885 WP_001029580.1.82900 WP_001029580.1.82911 WP_001029580.1.82921 WP_001029580.1.82929 WP_001029580.1.8293 WP_001029580.1.82958 WP_001029580.1.82969 WP_001029580.1.82970 WP_001029580.1.82971 WP_001029580.1.82985 WP_001029580.1.82994 WP_001029580.1.83042 WP_001029580.1.83055 WP_001029580.1.83064 WP_001029580.1.83067 WP_001029580.1.83094 WP_001029580.1.83107 WP_001029580.1.83111 WP_001029580.1.83115 WP_001029580.1.83123 WP_001029580.1.83135 WP_001029580.1.83136 WP_001029580.1.8315 WP_001029580.1.83158 WP_001029580.1.8316 WP_001029580.1.83168 WP_001029580.1.83169 WP_001029580.1.83174 WP_001029580.1.83189 WP_001029580.1.83199 WP_001029580.1.83219 WP_001029580.1.83227 WP_001029580.1.83231 WP_001029580.1.83239 WP_001029580.1.83241 WP_001029580.1.83242 WP_001029580.1.83244 WP_001029580.1.83278 WP_001029580.1.83281 WP_001029580.1.83306 WP_001029580.1.8331 WP_001029580.1.83311 WP_001029580.1.83319 WP_001029580.1.83335 WP_001029580.1.83371 WP_001029580.1.83403 WP_001029580.1.83414 WP_001029580.1.83432 WP_001029580.1.83439 WP_001029580.1.83443 WP_001029580.1.83446 WP_001029580.1.83455 WP_001029580.1.83456 WP_001029580.1.83457 WP_001029580.1.8347 WP_001029580.1.83471 WP_001029580.1.83485 WP_001029580.1.83489 WP_001029580.1.83518 WP_001029580.1.8352 WP_001029580.1.83527 WP_001029580.1.83574 WP_001029580.1.83577 WP_001029580.1.83578 WP_001029580.1.83587 WP_001029580.1.8360 WP_001029580.1.83604 WP_001029580.1.83606 WP_001029580.1.83613 WP_001029580.1.83634 WP_001029580.1.83635 WP_001029580.1.83636 WP_001029580.1.83681 WP_001029580.1.83702 WP_001029580.1.83713 WP_001029580.1.83719 WP_001029580.1.83726 WP_001029580.1.83730 WP_001029580.1.83731 WP_001029580.1.83732 WP_001029580.1.83752 WP_001029580.1.83776 WP_001029580.1.83789 WP_001029580.1.83790 WP_001029580.1.83796 WP_001029580.1.83840 WP_001029580.1.83843 WP_001029580.1.83846 WP_001029580.1.83863 WP_001029580.1.83866 WP_001029580.1.83888 WP_001029580.1.83898 WP_001029580.1.83899 WP_001029580.1.83910 WP_001029580.1.8392 WP_001029580.1.83922 WP_001029580.1.83934 WP_001029580.1.83956 WP_001029580.1.83961 WP_001029580.1.83964 WP_001029580.1.83974 WP_001029580.1.83978 WP_001029580.1.8398 WP_001029580.1.84013 WP_001029580.1.84017 WP_001029580.1.84038 WP_001029580.1.84044 WP_001029580.1.84052 WP_001029580.1.84056 WP_001029580.1.84061 WP_001029580.1.84062 WP_001029580.1.84065 WP_001029580.1.84080 WP_001029580.1.84092 WP_001029580.1.84095 WP_001029580.1.84111 WP_001029580.1.84113 WP_001029580.1.84116 WP_001029580.1.84125 WP_001029580.1.84147 WP_001029580.1.8416 WP_001029580.1.84175 WP_001029580.1.84182 WP_001029580.1.84211 WP_001029580.1.84213 WP_001029580.1.84214 WP_001029580.1.84220 WP_001029580.1.84225 WP_001029580.1.8423 WP_001029580.1.84237 WP_001029580.1.84258 WP_001029580.1.84263 WP_001029580.1.84292 WP_001029580.1.84304 WP_001029580.1.84305 WP_001029580.1.84363 WP_001029580.1.84382 WP_001029580.1.84444 WP_001029580.1.84477 WP_001029580.1.84500 WP_001029580.1.84505 WP_001029580.1.84513 WP_001029580.1.84521 WP_001029580.1.84530 WP_001029580.1.8454 WP_001029580.1.84552 WP_001029580.1.84576 WP_001029580.1.846 WP_001029580.1.84613 WP_001029580.1.84633 WP_001029580.1.84636 WP_001029580.1.84640 WP_001029580.1.84643 WP_001029580.1.84658 WP_001029580.1.84664 WP_001029580.1.84667 WP_001029580.1.84669 WP_001029580.1.84672 WP_001029580.1.84724 WP_001029580.1.84746 WP_001029580.1.84747 WP_001029580.1.84785 WP_001029580.1.8481 WP_001029580.1.84821 WP_001029580.1.84827 WP_001029580.1.8483 WP_001029580.1.84842 WP_001029580.1.84858 WP_001029580.1.84897 WP_001029580.1.84910 WP_001029580.1.84931 WP_001029580.1.84955 WP_001029580.1.84979 WP_001029580.1.84991 WP_001029580.1.84998 WP_001029580.1.8500 WP_001029580.1.85019 WP_001029580.1.85021 WP_001029580.1.85033 WP_001029580.1.8506 WP_001029580.1.85061 WP_001029580.1.85062 WP_001029580.1.85064 WP_001029580.1.8507 WP_001029580.1.85093 WP_001029580.1.85095 WP_001029580.1.8510 WP_001029580.1.85103 WP_001029580.1.85111 WP_001029580.1.85114 WP_001029580.1.85123 WP_001029580.1.85171 WP_001029580.1.85184 WP_001029580.1.85195 WP_001029580.1.85212 WP_001029580.1.85215 WP_001029580.1.85221 WP_001029580.1.85222 WP_001029580.1.85233 WP_001029580.1.85258 WP_001029580.1.85286 WP_001029580.1.8534 WP_001029580.1.85373 WP_001029580.1.85379 WP_001029580.1.85392 WP_001029580.1.85393 WP_001029580.1.85400 WP_001029580.1.85418 WP_001029580.1.85427 WP_001029580.1.85434 WP_001029580.1.85452 WP_001029580.1.8547 WP_001029580.1.85470 WP_001029580.1.85494 WP_001029580.1.85496 WP_001029580.1.85508 WP_001029580.1.85522 WP_001029580.1.85548 WP_001029580.1.85552 WP_001029580.1.85581 WP_001029580.1.85608 WP_001029580.1.85609 WP_001029580.1.85613 WP_001029580.1.85624 WP_001029580.1.85625 WP_001029580.1.85629 WP_001029580.1.85652 WP_001029580.1.85659 WP_001029580.1.8569 WP_001029580.1.85697 WP_001029580.1.85718 WP_001029580.1.8574 WP_001029580.1.85748 WP_001029580.1.85750 WP_001029580.1.85760 WP_001029580.1.85789 WP_001029580.1.85826 WP_001029580.1.85849 WP_001029580.1.85861 WP_001029580.1.85869 WP_001029580.1.85881 WP_001029580.1.85882 WP_001029580.1.85896 WP_001029580.1.8590 WP_001029580.1.85907 WP_001029580.1.85918 WP_001029580.1.85921 WP_001029580.1.85942 WP_001029580.1.85947 WP_001029580.1.85962 WP_001029580.1.85973 WP_001029580.1.86013 WP_001029580.1.86020 WP_001029580.1.86040 WP_001029580.1.86061 WP_001029580.1.86075 WP_001029580.1.86081 WP_001029580.1.86118 WP_001029580.1.8612 WP_001029580.1.86130 WP_001029580.1.8618 WP_001029580.1.86238 WP_001029580.1.86254 WP_001029580.1.86282 WP_001029580.1.86296 WP_001029580.1.86297 WP_001029580.1.86300 WP_001029580.1.86312 WP_001029580.1.86313 WP_001029580.1.86320 WP_001029580.1.86326 WP_001029580.1.86330 WP_001029580.1.86346 WP_001029580.1.86360 WP_001029580.1.86403 WP_001029580.1.86407 WP_001029580.1.86423 WP_001029580.1.86440 WP_001029580.1.86445 WP_001029580.1.86456 WP_001029580.1.86457 WP_001029580.1.8646 WP_001029580.1.86496 WP_001029580.1.86503 WP_001029580.1.86507 WP_001029580.1.86529 WP_001029580.1.86539 WP_001029580.1.86546 WP_001029580.1.8655 WP_001029580.1.86558 WP_001029580.1.86559 WP_001029580.1.86612 WP_001029580.1.86614 WP_001029580.1.86631 WP_001029580.1.86632 WP_001029580.1.86636 WP_001029580.1.86655 WP_001029580.1.86659 WP_001029580.1.86685 WP_001029580.1.86689 WP_001029580.1.86702 WP_001029580.1.86721 WP_001029580.1.86722 WP_001029580.1.86723 WP_001029580.1.86724 WP_001029580.1.8674 WP_001029580.1.86742 WP_001029580.1.86746 WP_001029580.1.86747 WP_001029580.1.86750 WP_001029580.1.86751 WP_001029580.1.86772 WP_001029580.1.86784 WP_001029580.1.86798 WP_001029580.1.86812 WP_001029580.1.86841 WP_001029580.1.86875 WP_001029580.1.86880 WP_001029580.1.86887 WP_001029580.1.86918 WP_001029580.1.86939 WP_001029580.1.86996 WP_001029580.1.86998 WP_001029580.1.87065 WP_001029580.1.87069 WP_001029580.1.87073 WP_001029580.1.87077 WP_001029580.1.8708 WP_001029580.1.87084 WP_001029580.1.87094 WP_001029580.1.87135 WP_001029580.1.87138 WP_001029580.1.87160 WP_001029580.1.87174 WP_001029580.1.87200 WP_001029580.1.87229 WP_001029580.1.8724 WP_001029580.1.87248 WP_001029580.1.87289 WP_001029580.1.87297 WP_001029580.1.87317 WP_001029580.1.87331 WP_001029580.1.87332 WP_001029580.1.87336 WP_001029580.1.8734 WP_001029580.1.87342 WP_001029580.1.87347 WP_001029580.1.87352 WP_001029580.1.87383 WP_001029580.1.87422 WP_001029580.1.8744 WP_001029580.1.8747 WP_001029580.1.87510 WP_001029580.1.87521 WP_001029580.1.87548 WP_001029580.1.87550 WP_001029580.1.87592 WP_001029580.1.87604 WP_001029580.1.87621 WP_001029580.1.87661 WP_001029580.1.87664 WP_001029580.1.87681 WP_001029580.1.87699 WP_001029580.1.877 WP_001029580.1.87719 WP_001029580.1.87771 WP_001029580.1.87774 WP_001029580.1.87775 WP_001029580.1.87799 WP_001029580.1.87815 WP_001029580.1.87824 WP_001029580.1.87829 WP_001029580.1.87833 WP_001029580.1.87839 WP_001029580.1.87868 WP_001029580.1.87872 WP_001029580.1.87901 WP_001029580.1.87904 WP_001029580.1.87909 WP_001029580.1.87910 WP_001029580.1.87922 WP_001029580.1.87942 WP_001029580.1.87946 WP_001029580.1.87961 WP_001029580.1.87969 WP_001029580.1.87971 WP_001029580.1.87993 WP_001029580.1.87998 WP_001029580.1.88008 WP_001029580.1.88033 WP_001029580.1.88054 WP_001029580.1.88084 WP_001029580.1.88103 WP_001029580.1.88113 WP_001029580.1.88129 WP_001029580.1.88141 WP_001029580.1.88167 WP_001029580.1.88170 WP_001029580.1.88172 WP_001029580.1.88176 WP_001029580.1.8818 WP_001029580.1.88182 WP_001029580.1.88196 WP_001029580.1.88203 WP_001029580.1.88206 WP_001029580.1.88218 WP_001029580.1.88224 WP_001029580.1.88225 WP_001029580.1.8823 WP_001029580.1.88232 WP_001029580.1.88254 WP_001029580.1.88280 WP_001029580.1.883 WP_001029580.1.88343 WP_001029580.1.88365 WP_001029580.1.88387 WP_001029580.1.88391 WP_001029580.1.88433 WP_001029580.1.88488 WP_001029580.1.88509 WP_001029580.1.88519 WP_001029580.1.88523 WP_001029580.1.88544 WP_001029580.1.8858 WP_001029580.1.88586 WP_001029580.1.88602 WP_001029580.1.88652 WP_001029580.1.88662 WP_001029580.1.88669 WP_001029580.1.88693 WP_001029580.1.88697 WP_001029580.1.88699 WP_001029580.1.88700 WP_001029580.1.88716 WP_001029580.1.88719 WP_001029580.1.88722 WP_001029580.1.8876 WP_001029580.1.88811 WP_001029580.1.88825 WP_001029580.1.88840 WP_001029580.1.88841 WP_001029580.1.88848 WP_001029580.1.88862 WP_001029580.1.88869 WP_001029580.1.88904 WP_001029580.1.88932 WP_001029580.1.88939 WP_001029580.1.88940 WP_001029580.1.88963 WP_001029580.1.88984 WP_001029580.1.89016 WP_001029580.1.89029 WP_001029580.1.89032 WP_001029580.1.89034 WP_001029580.1.89057 WP_001029580.1.89059 WP_001029580.1.89094 WP_001029580.1.89123 WP_001029580.1.89134 WP_001029580.1.89161 WP_001029580.1.89190 WP_001029580.1.89208 WP_001029580.1.89210 WP_001029580.1.89224 WP_001029580.1.89253 WP_001029580.1.89254 WP_001029580.1.8926 WP_001029580.1.89282 WP_001029580.1.8930 WP_001029580.1.89310 WP_001029580.1.89346 WP_001029580.1.89369 WP_001029580.1.89370 WP_001029580.1.89375 WP_001029580.1.89442 WP_001029580.1.89444 WP_001029580.1.89446 WP_001029580.1.89489 WP_001029580.1.89493 WP_001029580.1.89498 WP_001029580.1.89504 WP_001029580.1.89532 WP_001029580.1.89539 WP_001029580.1.89563 WP_001029580.1.89565 WP_001029580.1.89585 WP_001029580.1.89620 WP_001029580.1.89624 WP_001029580.1.8963 WP_001029580.1.89640 WP_001029580.1.89645 WP_001029580.1.89649 WP_001029580.1.89652 WP_001029580.1.89658 WP_001029580.1.89681 WP_001029580.1.89684 WP_001029580.1.8970 WP_001029580.1.89702 WP_001029580.1.89708 WP_001029580.1.89720 WP_001029580.1.8973 WP_001029580.1.8975 WP_001029580.1.89757 WP_001029580.1.89763 WP_001029580.1.89793 WP_001029580.1.89806 WP_001029580.1.89828 WP_001029580.1.89837 WP_001029580.1.89843 WP_001029580.1.89850 WP_001029580.1.89858 WP_001029580.1.89864 WP_001029580.1.89875 WP_001029580.1.89881 WP_001029580.1.89891 WP_001029580.1.89905 WP_001029580.1.89907 WP_001029580.1.89913 WP_001029580.1.89930 WP_001029580.1.89942 WP_001029580.1.89945 WP_001029580.1.89967 WP_001029580.1.89982 WP_001029580.1.90001 WP_001029580.1.90028 WP_001029580.1.90035 WP_001029580.1.90059 WP_001029580.1.90062 WP_001029580.1.90113 WP_001029580.1.90119 WP_001029580.1.90124 WP_001029580.1.90143 WP_001029580.1.90158 WP_001029580.1.90163 WP_001029580.1.90166 WP_001029580.1.90178 WP_001029580.1.9018 WP_001029580.1.90192 WP_001029580.1.90202 WP_001029580.1.90213 WP_001029580.1.90234 WP_001029580.1.90261 WP_001029580.1.9027 WP_001029580.1.90281 WP_001029580.1.90304 WP_001029580.1.90312 WP_001029580.1.90313 WP_001029580.1.90319 WP_001029580.1.90339 WP_001029580.1.90356 WP_001029580.1.90361 WP_001029580.1.90385 WP_001029580.1.90396 WP_001029580.1.90397 WP_001029580.1.90410 WP_001029580.1.90425 WP_001029580.1.90443 WP_001029580.1.90463 WP_001029580.1.90482 WP_001029580.1.90486 WP_001029580.1.90495 WP_001029580.1.90502 WP_001029580.1.90529 WP_001029580.1.90535 WP_001029580.1.90539 WP_001029580.1.90565 WP_001029580.1.90583 WP_001029580.1.90597 WP_001029580.1.90603 WP_001029580.1.90606 WP_001029580.1.90615 WP_001029580.1.90618 WP_001029580.1.90628 WP_001029580.1.90663 WP_001029580.1.90676 WP_001029580.1.90678 WP_001029580.1.90693 WP_001029580.1.90695 WP_001029580.1.907 WP_001029580.1.90712 WP_001029580.1.90727 WP_001029580.1.90731 WP_001029580.1.90733 WP_001029580.1.90762 WP_001029580.1.90768 WP_001029580.1.90776 WP_001029580.1.90778 WP_001029580.1.90805 WP_001029580.1.90809 WP_001029580.1.90869 WP_001029580.1.90882 WP_001029580.1.90894 WP_001029580.1.90897 WP_001029580.1.9090 WP_001029580.1.90900 WP_001029580.1.90925 WP_001029580.1.90927 WP_001029580.1.90929 WP_001029580.1.90936 WP_001029580.1.90942 WP_001029580.1.90965 WP_001029580.1.90970 WP_001029580.1.90974 WP_001029580.1.90980 WP_001029580.1.90989 WP_001029580.1.91015 WP_001029580.1.91034 WP_001029580.1.91041 WP_001029580.1.91052 WP_001029580.1.91057 WP_001029580.1.91078 WP_001029580.1.91079 WP_001029580.1.9108 WP_001029580.1.91099 WP_001029580.1.91119 WP_001029580.1.91125 WP_001029580.1.91127 WP_001029580.1.91129 WP_001029580.1.91131 WP_001029580.1.9115 WP_001029580.1.91154 WP_001029580.1.91172 WP_001029580.1.91176 WP_001029580.1.91178 WP_001029580.1.91193 WP_001029580.1.9124 WP_001029580.1.91269 WP_001029580.1.91276 WP_001029580.1.91292 WP_001029580.1.91321 WP_001029580.1.91339 WP_001029580.1.91358 WP_001029580.1.91369 WP_001029580.1.91383 WP_001029580.1.91388 WP_001029580.1.91407 WP_001029580.1.91412 WP_001029580.1.91413 WP_001029580.1.91432 WP_001029580.1.9146 WP_001029580.1.91468 WP_001029580.1.91478 WP_001029580.1.91481 WP_001029580.1.91545 WP_001029580.1.91562 WP_001029580.1.9162 WP_001029580.1.91650 WP_001029580.1.91653 WP_001029580.1.91656 WP_001029580.1.91686 WP_001029580.1.91705 WP_001029580.1.91714 WP_001029580.1.91718 WP_001029580.1.91719 WP_001029580.1.9173 WP_001029580.1.91775 WP_001029580.1.91811 WP_001029580.1.91815 WP_001029580.1.91821 WP_001029580.1.91839 WP_001029580.1.9184 WP_001029580.1.91858 WP_001029580.1.91878 WP_001029580.1.91881 WP_001029580.1.91886 WP_001029580.1.91888 WP_001029580.1.91902 WP_001029580.1.9192 WP_001029580.1.91923 WP_001029580.1.91924 WP_001029580.1.91927 WP_001029580.1.91934 WP_001029580.1.91947 WP_001029580.1.91960 WP_001029580.1.91972 WP_001029580.1.91985 WP_001029580.1.92006 WP_001029580.1.92010 WP_001029580.1.92015 WP_001029580.1.92027 WP_001029580.1.92032 WP_001029580.1.92034 WP_001029580.1.92045 WP_001029580.1.92061 WP_001029580.1.92065 WP_001029580.1.9207 WP_001029580.1.92077 WP_001029580.1.92086 WP_001029580.1.92092 WP_001029580.1.92103 WP_001029580.1.92116 WP_001029580.1.92121 WP_001029580.1.92124 WP_001029580.1.92166 WP_001029580.1.92167 WP_001029580.1.92168 WP_001029580.1.92176 WP_001029580.1.92177 WP_001029580.1.92178 WP_001029580.1.9218 WP_001029580.1.92182 WP_001029580.1.92187 WP_001029580.1.92225 WP_001029580.1.92245 WP_001029580.1.92248 WP_001029580.1.9225 WP_001029580.1.92261 WP_001029580.1.92271 WP_001029580.1.92298 WP_001029580.1.92301 WP_001029580.1.92342 WP_001029580.1.92344 WP_001029580.1.92351 WP_001029580.1.92353 WP_001029580.1.92355 WP_001029580.1.92369 WP_001029580.1.92386 WP_001029580.1.92389 WP_001029580.1.92400 WP_001029580.1.92457 WP_001029580.1.92464 WP_001029580.1.92487 WP_001029580.1.92491 WP_001029580.1.92502 WP_001029580.1.92558 WP_001029580.1.92563 WP_001029580.1.92564 WP_001029580.1.9260 WP_001029580.1.92631 WP_001029580.1.92640 WP_001029580.1.92652 WP_001029580.1.92656 WP_001029580.1.92682 WP_001029580.1.92724 WP_001029580.1.92732 WP_001029580.1.92740 WP_001029580.1.9275 WP_001029580.1.92755 WP_001029580.1.92812 WP_001029580.1.92814 WP_001029580.1.92850 WP_001029580.1.92854 WP_001029580.1.92866 WP_001029580.1.92872 WP_001029580.1.92874 WP_001029580.1.92878 WP_001029580.1.92896 WP_001029580.1.92906 WP_001029580.1.92913 WP_001029580.1.92940 WP_001029580.1.92962 WP_001029580.1.92967 WP_001029580.1.92969 WP_001029580.1.92971 WP_001029580.1.92973 WP_001029580.1.9299 WP_001029580.1.93021 WP_001029580.1.93075 WP_001029580.1.93084 WP_001029580.1.93096 WP_001029580.1.93108 WP_001029580.1.93129 WP_001029580.1.93135 WP_001029580.1.93152 WP_001029580.1.93154 WP_001029580.1.93156 WP_001029580.1.93158 WP_001029580.1.93178 WP_001029580.1.93210 WP_001029580.1.93238 WP_001029580.1.93253 WP_001029580.1.9326 WP_001029580.1.93262 WP_001029580.1.93274 WP_001029580.1.93279 WP_001029580.1.93281 WP_001029580.1.93285 WP_001029580.1.93294 WP_001029580.1.93311 WP_001029580.1.93314 WP_001029580.1.93347 WP_001029580.1.93361 WP_001029580.1.9339 WP_001029580.1.93398 WP_001029580.1.93404 WP_001029580.1.93442 WP_001029580.1.9345 WP_001029580.1.93452 WP_001029580.1.93462 WP_001029580.1.9347 WP_001029580.1.93474 WP_001029580.1.93475 WP_001029580.1.93479 WP_001029580.1.9348 WP_001029580.1.93489 WP_001029580.1.93496 WP_001029580.1.935 WP_001029580.1.93506 WP_001029580.1.93515 WP_001029580.1.93522 WP_001029580.1.93525 WP_001029580.1.93548 WP_001029580.1.93550 WP_001029580.1.93592 WP_001029580.1.93595 WP_001029580.1.93606 WP_001029580.1.93609 WP_001029580.1.93616 WP_001029580.1.93636 WP_001029580.1.9364 WP_001029580.1.93641 WP_001029580.1.93680 WP_001029580.1.9369 WP_001029580.1.93696 WP_001029580.1.93700 WP_001029580.1.93703 WP_001029580.1.93720 WP_001029580.1.93773 WP_001029580.1.93785 WP_001029580.1.93805 WP_001029580.1.93814 WP_001029580.1.93832 WP_001029580.1.93835 WP_001029580.1.93865 WP_001029580.1.93869 WP_001029580.1.93878 WP_001029580.1.93906 WP_001029580.1.93910 WP_001029580.1.93915 WP_001029580.1.93947 WP_001029580.1.93974 WP_001029580.1.93982 WP_001029580.1.93992 WP_001029580.1.94024 WP_001029580.1.94029 WP_001029580.1.9403 WP_001029580.1.94061 WP_001029580.1.94090 WP_001029580.1.94092 WP_001029580.1.94101 WP_001029580.1.94104 WP_001029580.1.94105 WP_001029580.1.94139 WP_001029580.1.9414 WP_001029580.1.94145 WP_001029580.1.94148 WP_001029580.1.94157 WP_001029580.1.94170 WP_001029580.1.94195 WP_001029580.1.94220 WP_001029580.1.94258 WP_001029580.1.94260 WP_001029580.1.94263 WP_001029580.1.94269 WP_001029580.1.94272 WP_001029580.1.94274 WP_001029580.1.94279 WP_001029580.1.943 WP_001029580.1.94316 WP_001029580.1.94323 WP_001029580.1.94330 WP_001029580.1.94334 WP_001029580.1.94357 WP_001029580.1.94368 WP_001029580.1.94369 WP_001029580.1.94391 WP_001029580.1.94395 WP_001029580.1.94425 WP_001029580.1.94442 WP_001029580.1.94444 WP_001029580.1.94459 WP_001029580.1.94466 WP_001029580.1.94469 WP_001029580.1.94476 WP_001029580.1.945 WP_001029580.1.94503 WP_001029580.1.94509 WP_001029580.1.94515 WP_001029580.1.9452 WP_001029580.1.94526 WP_001029580.1.94539 WP_001029580.1.94558 WP_001029580.1.94559 WP_001029580.1.94570 WP_001029580.1.94577 WP_001029580.1.9458 WP_001029580.1.94595 WP_001029580.1.94604 WP_001029580.1.94643 WP_001029580.1.94644 WP_001029580.1.94651 WP_001029580.1.94652 WP_001029580.1.94689 WP_001029580.1.94708 WP_001029580.1.94711 WP_001029580.1.94724 WP_001029580.1.94771 WP_001029580.1.94778 WP_001029580.1.94810 WP_001029580.1.94811 WP_001029580.1.9483 WP_001029580.1.94876 WP_001029580.1.94883 WP_001029580.1.94885 WP_001029580.1.94925 WP_001029580.1.94940 WP_001029580.1.94954 WP_001029580.1.95013 WP_001029580.1.95041 WP_001029580.1.95050 WP_001029580.1.95058 WP_001029580.1.95059 WP_001029580.1.95069 WP_001029580.1.95073 WP_001029580.1.9508 WP_001029580.1.95098 WP_001029580.1.95104 WP_001029580.1.95106 WP_001029580.1.95113 WP_001029580.1.95125 WP_001029580.1.95128 WP_001029580.1.95153 WP_001029580.1.95177 WP_001029580.1.9518 WP_001029580.1.95192 WP_001029580.1.95208 WP_001029580.1.95209 WP_001029580.1.95240 WP_001029580.1.95251 WP_001029580.1.95258 WP_001029580.1.95264 WP_001029580.1.95276 WP_001029580.1.9528 WP_001029580.1.953 WP_001029580.1.95303 WP_001029580.1.95312 WP_001029580.1.95321 WP_001029580.1.95322 WP_001029580.1.95356 WP_001029580.1.95369 WP_001029580.1.95376 WP_001029580.1.95458 WP_001029580.1.95479 WP_001029580.1.95528 WP_001029580.1.95531 WP_001029580.1.95532 WP_001029580.1.95553 WP_001029580.1.95583 WP_001029580.1.95602 WP_001029580.1.95605 WP_001029580.1.95621 WP_001029580.1.95642 WP_001029580.1.95688 WP_001029580.1.95692 WP_001029580.1.95698 WP_001029580.1.95725 WP_001029580.1.95732 WP_001029580.1.95736 WP_001029580.1.95738 WP_001029580.1.95740 WP_001029580.1.95762 WP_001029580.1.95765 WP_001029580.1.95769 WP_001029580.1.95778 WP_001029580.1.95807 WP_001029580.1.95822 WP_001029580.1.95853 WP_001029580.1.95856 WP_001029580.1.95868 WP_001029580.1.95870 WP_001029580.1.95876 WP_001029580.1.95879 WP_001029580.1.95881 WP_001029580.1.95904 WP_001029580.1.9592 WP_001029580.1.95925 WP_001029580.1.95942 WP_001029580.1.95956 WP_001029580.1.95968 WP_001029580.1.95992 WP_001029580.1.95998 WP_001029580.1.96003 WP_001029580.1.96007 WP_001029580.1.96011 WP_001029580.1.96012 WP_001029580.1.96024 WP_001029580.1.96048 WP_001029580.1.96049 WP_001029580.1.96096 WP_001029580.1.96100 WP_001029580.1.96103 WP_001029580.1.96106 WP_001029580.1.96109 WP_001029580.1.9611 WP_001029580.1.96111 WP_001029580.1.96117 WP_001029580.1.9612 WP_001029580.1.96120 WP_001029580.1.96126 WP_001029580.1.96138 WP_001029580.1.9615 WP_001029580.1.96178 WP_001029580.1.96181 WP_001029580.1.96189 WP_001029580.1.9620 WP_001029580.1.96205 WP_001029580.1.9621 WP_001029580.1.96227 WP_001029580.1.96244 WP_001029580.1.96249 WP_001029580.1.96277 WP_001029580.1.96307 WP_001029580.1.96309 WP_001029580.1.9632 WP_001029580.1.96321 WP_001029580.1.96324 WP_001029580.1.96336 WP_001029580.1.96350 WP_001029580.1.96397 WP_001029580.1.96421 WP_001029580.1.96432 WP_001029580.1.96436 WP_001029580.1.96464 WP_001029580.1.96466 WP_001029580.1.96487 WP_001029580.1.96499 WP_001029580.1.96517 WP_001029580.1.96565 WP_001029580.1.96580 WP_001029580.1.96582 WP_001029580.1.96595 WP_001029580.1.966 WP_001029580.1.96601 WP_001029580.1.96619 WP_001029580.1.9662 WP_001029580.1.96629 WP_001029580.1.96636 WP_001029580.1.96652 WP_001029580.1.967 WP_001029580.1.96703 WP_001029580.1.96709 WP_001029580.1.96728 WP_001029580.1.96749 WP_001029580.1.96772 WP_001029580.1.96781 WP_001029580.1.96785 WP_001029580.1.96791 WP_001029580.1.9681 WP_001029580.1.96819 WP_001029580.1.96821 WP_001029580.1.96833 WP_001029580.1.96851 WP_001029580.1.96872 WP_001029580.1.96873 WP_001029580.1.96875 WP_001029580.1.96887 WP_001029580.1.96888 WP_001029580.1.96889 WP_001029580.1.96899 WP_001029580.1.96901 WP_001029580.1.96913 WP_001029580.1.96939 WP_001029580.1.96961 WP_001029580.1.96974 WP_001029580.1.96994 WP_001029580.1.97040 WP_001029580.1.97045 WP_001029580.1.97046 WP_001029580.1.97048 WP_001029580.1.9705 WP_001029580.1.97051 WP_001029580.1.97066 WP_001029580.1.97073 WP_001029580.1.97091 WP_001029580.1.971 WP_001029580.1.9712 WP_001029580.1.97158 WP_001029580.1.97159 WP_001029580.1.97162 WP_001029580.1.97182 WP_001029580.1.97187 WP_001029580.1.972 WP_001029580.1.97252 WP_001029580.1.97265 WP_001029580.1.9727 WP_001029580.1.97278 WP_001029580.1.97284 WP_001029580.1.9730 WP_001029580.1.97308 WP_001029580.1.97354 WP_001029580.1.97362 WP_001029580.1.97381 WP_001029580.1.97383 WP_001029580.1.97410 WP_001029580.1.97436 WP_001029580.1.97442 WP_001029580.1.97476 WP_001029580.1.97479 WP_001029580.1.97482 WP_001029580.1.97524 WP_001029580.1.97543 WP_001029580.1.97553 WP_001029580.1.97556 WP_001029580.1.9757 WP_001029580.1.97570 WP_001029580.1.97595 WP_001029580.1.9760 WP_001029580.1.97610 WP_001029580.1.97644 WP_001029580.1.97657 WP_001029580.1.97658 WP_001029580.1.97686 WP_001029580.1.97702 WP_001029580.1.97733 WP_001029580.1.9778 WP_001029580.1.97804 WP_001029580.1.97808 WP_001029580.1.97810 WP_001029580.1.97824 WP_001029580.1.97829 WP_001029580.1.97831 WP_001029580.1.97856 WP_001029580.1.97859 WP_001029580.1.97862 WP_001029580.1.97875 WP_001029580.1.97876 WP_001029580.1.97878 WP_001029580.1.97879 WP_001029580.1.97886 WP_001029580.1.97891 WP_001029580.1.97892 WP_001029580.1.97901 WP_001029580.1.97921 WP_001029580.1.97925 WP_001029580.1.97931 WP_001029580.1.97944 WP_001029580.1.97980 WP_001029580.1.97994 WP_001029580.1.97998 WP_001029580.1.98044 WP_001029580.1.98045 WP_001029580.1.98049 WP_001029580.1.9806 WP_001029580.1.98062 WP_001029580.1.98074 WP_001029580.1.98084 WP_001029580.1.98094 WP_001029580.1.98103 WP_001029580.1.9812 WP_001029580.1.98159 WP_001029580.1.98168 WP_001029580.1.9819 WP_001029580.1.98192 WP_001029580.1.98196 WP_001029580.1.98198 WP_001029580.1.98217 WP_001029580.1.98234 WP_001029580.1.98245 WP_001029580.1.98259 WP_001029580.1.98265 WP_001029580.1.98270 WP_001029580.1.98273 WP_001029580.1.98277 WP_001029580.1.98286 WP_001029580.1.98288 WP_001029580.1.98290 WP_001029580.1.983 WP_001029580.1.98319 WP_001029580.1.98376 WP_001029580.1.98388 WP_001029580.1.98398 WP_001029580.1.98427 WP_001029580.1.98428 WP_001029580.1.98435 WP_001029580.1.98449 WP_001029580.1.98460 WP_001029580.1.98461 WP_001029580.1.98467 WP_001029580.1.98475 WP_001029580.1.98504 WP_001029580.1.98518 WP_001029580.1.98539 WP_001029580.1.98545 WP_001029580.1.98589 WP_001029580.1.98623 WP_001029580.1.98632 WP_001029580.1.98635 WP_001029580.1.98647 WP_001029580.1.98648 WP_001029580.1.98679 WP_001029580.1.9868 WP_001029580.1.98711 WP_001029580.1.98714 WP_001029580.1.98732 WP_001029580.1.98740 WP_001029580.1.98747 WP_001029580.1.98755 WP_001029580.1.98759 WP_001029580.1.98771 WP_001029580.1.98781 WP_001029580.1.9879 WP_001029580.1.98799 WP_001029580.1.98828 WP_001029580.1.98830 WP_001029580.1.98833 WP_001029580.1.98851 WP_001029580.1.98855 WP_001029580.1.98859 WP_001029580.1.98862 WP_001029580.1.98879 WP_001029580.1.98893 WP_001029580.1.98896 WP_001029580.1.98905 WP_001029580.1.98915 WP_001029580.1.98934 WP_001029580.1.98941 WP_001029580.1.98943 WP_001029580.1.9895 WP_001029580.1.98957 WP_001029580.1.98961 WP_001029580.1.98989 WP_001029580.1.98990 WP_001029580.1.99001 WP_001029580.1.99010 WP_001029580.1.9902 WP_001029580.1.99028 WP_001029580.1.99034 WP_001029580.1.99096 WP_001029580.1.99111 WP_001029580.1.99114 WP_001029580.1.99126 WP_001029580.1.99138 WP_001029580.1.99143 WP_001029580.1.99148 WP_001029580.1.9915 WP_001029580.1.99181 WP_001029580.1.99202 WP_001029580.1.99203 WP_001029580.1.99223 WP_001029580.1.99225 WP_001029580.1.9926 WP_001029580.1.99291 WP_001029580.1.99301 WP_001029580.1.99309 WP_001029580.1.9931 WP_001029580.1.99313 WP_001029580.1.99314 WP_001029580.1.99329 WP_001029580.1.99342 WP_001029580.1.99356 WP_001029580.1.99358 WP_001029580.1.99362 WP_001029580.1.99364 WP_001029580.1.99371 WP_001029580.1.99382 WP_001029580.1.99387 WP_001029580.1.99436 WP_001029580.1.99451 WP_001029580.1.99465 WP_001029580.1.99478 WP_001029580.1.99547 WP_001029580.1.99554 WP_001029580.1.99557 WP_001029580.1.99565 WP_001029580.1.99574 WP_001029580.1.99589 WP_001029580.1.99593 WP_001029580.1.99596 WP_001029580.1.99600 WP_001029580.1.99606 WP_001029580.1.99610 WP_001029580.1.99624 WP_001029580.1.99628 WP_001029580.1.99640 WP_001029580.1.99649 WP_001029580.1.99669 WP_001029580.1.99678 WP_001029580.1.99680 WP_001029580.1.99687 WP_001029580.1.9969 WP_001029580.1.997 WP_001029580.1.99732 WP_001029580.1.99753 WP_001029580.1.99760 WP_001029580.1.9978 WP_001029580.1.99781 WP_001029580.1.99787 WP_001029580.1.99790 WP_001029580.1.99793 WP_001029580.1.9984 WP_001029580.1.99879 WP_001029580.1.99900 WP_001029580.1.99905 WP_001029580.1.99920 WP_001029580.1.99980 gi|182684724|ref|YP_001836471.1| gi|15901605|ref|NP_346209.1| gi|410477125|ref|YP_006743884.1| gi|387759881|ref|YP_006066859.1| gi|307068384|ref|YP_003877350.1| 170187.SP_1776 487213.SPT_1696 487214.SPH_1891 488221.SP70585_1821 488222.SPJ_1673 488223.SPP_1775 512566.SPG_1663 516950.SPCG_1754 561276.SPN23F_17870 gi|307127971|ref|YP_003880002.1| gi|194396881|ref|YP_002038368.1| gi|556561486|ref|YP_008730845.1| gi|169832424|ref|YP_001695149.1| gi|298503503|ref|YP_003725443.1| gi|225861578|ref|YP_002743087.1| gi|405760380|ref|YP_006700976.1| gi|480535371|ref|YP_007813281.1| gi|221232514|ref|YP_002511667.1| gi|225859531|ref|YP_002741041.1| gi|387757972|ref|YP_006064951.1| gi|480532747|ref|YP_007764950.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]