SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|225857499|ref|YP_002739010.1| from Streptococcus pneumoniae P1031

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225857499|ref|YP_002739010.1|
Domain Number 1 Region: 3-102
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.62e-22
Family Thioltransferase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|225857499|ref|YP_002739010.1|
Sequence length 105
Comment thioredoxin family protein [Streptococcus pneumoniae P1031]
Sequence
MIQPASLEELASLVEKAGKKVFLFVADWCGDCRYIYPALPEIEETNPEFTFIRMDRDQYM
DLAKLWDVYGIPSLVVLEKDKEIGRFVNRDRKSKEQINDFLAGLK
Download sequence
Identical sequences A0A062WM20 A0A0H2ZQ19 A0A158LFR4 B1I8B7 B2IM00 C1C9I1 C1CGK2 D6ZNQ1 G6LQ48 M5JYR1 M5KGI8 M5N5J1 Q8DNH1
gi|225855411|ref|YP_002736923.1| gi|169832418|ref|YP_001695273.1| gi|307128112|ref|YP_003880143.1| gi|15903769|ref|NP_359319.1| gi|387760015|ref|YP_006066993.1| NP_359319.1.60829 WP_000615767.1.100012 WP_000615767.1.100048 WP_000615767.1.100054 WP_000615767.1.10009 WP_000615767.1.100102 WP_000615767.1.100114 WP_000615767.1.100140 WP_000615767.1.100153 WP_000615767.1.10016 WP_000615767.1.100164 WP_000615767.1.100168 WP_000615767.1.100186 WP_000615767.1.10020 WP_000615767.1.100203 WP_000615767.1.100263 WP_000615767.1.100339 WP_000615767.1.100353 WP_000615767.1.100369 WP_000615767.1.100397 WP_000615767.1.100477 WP_000615767.1.100483 WP_000615767.1.10049 WP_000615767.1.100532 WP_000615767.1.100547 WP_000615767.1.100569 WP_000615767.1.100572 WP_000615767.1.10060 WP_000615767.1.100715 WP_000615767.1.100756 WP_000615767.1.100816 WP_000615767.1.100829 WP_000615767.1.100839 WP_000615767.1.100848 WP_000615767.1.100863 WP_000615767.1.100874 WP_000615767.1.100892 WP_000615767.1.100911 WP_000615767.1.100937 WP_000615767.1.100947 WP_000615767.1.100997 WP_000615767.1.10103 WP_000615767.1.101044 WP_000615767.1.101045 WP_000615767.1.101061 WP_000615767.1.101062 WP_000615767.1.101066 WP_000615767.1.101098 WP_000615767.1.101106 WP_000615767.1.101135 WP_000615767.1.101176 WP_000615767.1.101178 WP_000615767.1.101181 WP_000615767.1.101201 WP_000615767.1.101205 WP_000615767.1.101213 WP_000615767.1.101219 WP_000615767.1.10123 WP_000615767.1.101232 WP_000615767.1.101241 WP_000615767.1.101250 WP_000615767.1.101256 WP_000615767.1.101274 WP_000615767.1.101286 WP_000615767.1.101287 WP_000615767.1.101315 WP_000615767.1.101369 WP_000615767.1.101373 WP_000615767.1.101435 WP_000615767.1.101464 WP_000615767.1.101482 WP_000615767.1.101483 WP_000615767.1.101484 WP_000615767.1.101497 WP_000615767.1.101517 WP_000615767.1.101560 WP_000615767.1.101577 WP_000615767.1.101599 WP_000615767.1.101614 WP_000615767.1.101689 WP_000615767.1.10169 WP_000615767.1.1017 WP_000615767.1.101709 WP_000615767.1.101729 WP_000615767.1.101763 WP_000615767.1.101765 WP_000615767.1.101784 WP_000615767.1.101803 WP_000615767.1.101806 WP_000615767.1.10183 WP_000615767.1.101842 WP_000615767.1.101847 WP_000615767.1.101876 WP_000615767.1.101891 WP_000615767.1.101912 WP_000615767.1.101946 WP_000615767.1.10196 WP_000615767.1.101988 WP_000615767.1.1020 WP_000615767.1.102004 WP_000615767.1.102006 WP_000615767.1.102077 WP_000615767.1.102091 WP_000615767.1.102114 WP_000615767.1.102115 WP_000615767.1.102134 WP_000615767.1.102141 WP_000615767.1.10221 WP_000615767.1.1026 WP_000615767.1.10261 WP_000615767.1.10314 WP_000615767.1.10316 WP_000615767.1.1034 WP_000615767.1.10364 WP_000615767.1.10391 WP_000615767.1.10426 WP_000615767.1.10434 WP_000615767.1.10437 WP_000615767.1.10449 WP_000615767.1.10458 WP_000615767.1.10494 WP_000615767.1.10499 WP_000615767.1.1050 WP_000615767.1.10500 WP_000615767.1.10515 WP_000615767.1.10571 WP_000615767.1.10585 WP_000615767.1.1059 WP_000615767.1.10591 WP_000615767.1.10599 WP_000615767.1.10619 WP_000615767.1.10622 WP_000615767.1.1068 WP_000615767.1.10683 WP_000615767.1.1069 WP_000615767.1.10692 WP_000615767.1.1070 WP_000615767.1.10713 WP_000615767.1.10731 WP_000615767.1.10747 WP_000615767.1.10760 WP_000615767.1.10807 WP_000615767.1.10812 WP_000615767.1.10819 WP_000615767.1.10820 WP_000615767.1.10827 WP_000615767.1.10828 WP_000615767.1.1083 WP_000615767.1.1091 WP_000615767.1.10932 WP_000615767.1.10933 WP_000615767.1.10934 WP_000615767.1.10952 WP_000615767.1.10987 WP_000615767.1.11 WP_000615767.1.11027 WP_000615767.1.11045 WP_000615767.1.11079 WP_000615767.1.11085 WP_000615767.1.11093 WP_000615767.1.11096 WP_000615767.1.11103 WP_000615767.1.11120 WP_000615767.1.11139 WP_000615767.1.11151 WP_000615767.1.11154 WP_000615767.1.11197 WP_000615767.1.11205 WP_000615767.1.11260 WP_000615767.1.11289 WP_000615767.1.11297 WP_000615767.1.11299 WP_000615767.1.1131 WP_000615767.1.11311 WP_000615767.1.11319 WP_000615767.1.11337 WP_000615767.1.11409 WP_000615767.1.11425 WP_000615767.1.11435 WP_000615767.1.11448 WP_000615767.1.11474 WP_000615767.1.11495 WP_000615767.1.11509 WP_000615767.1.11534 WP_000615767.1.11546 WP_000615767.1.11594 WP_000615767.1.11617 WP_000615767.1.11622 WP_000615767.1.11624 WP_000615767.1.1165 WP_000615767.1.11652 WP_000615767.1.11706 WP_000615767.1.11711 WP_000615767.1.11760 WP_000615767.1.11842 WP_000615767.1.11871 WP_000615767.1.11902 WP_000615767.1.1192 WP_000615767.1.11922 WP_000615767.1.11931 WP_000615767.1.11950 WP_000615767.1.11967 WP_000615767.1.1201 WP_000615767.1.12034 WP_000615767.1.12044 WP_000615767.1.12046 WP_000615767.1.12068 WP_000615767.1.12125 WP_000615767.1.12128 WP_000615767.1.12131 WP_000615767.1.12140 WP_000615767.1.12154 WP_000615767.1.12186 WP_000615767.1.1221 WP_000615767.1.12214 WP_000615767.1.12218 WP_000615767.1.12273 WP_000615767.1.12306 WP_000615767.1.12307 WP_000615767.1.12336 WP_000615767.1.12395 WP_000615767.1.12404 WP_000615767.1.12405 WP_000615767.1.12413 WP_000615767.1.12427 WP_000615767.1.12428 WP_000615767.1.12435 WP_000615767.1.12444 WP_000615767.1.12450 WP_000615767.1.12487 WP_000615767.1.12489 WP_000615767.1.12492 WP_000615767.1.12494 WP_000615767.1.12524 WP_000615767.1.12543 WP_000615767.1.12573 WP_000615767.1.1258 WP_000615767.1.12583 WP_000615767.1.12651 WP_000615767.1.12673 WP_000615767.1.12729 WP_000615767.1.12777 WP_000615767.1.128 WP_000615767.1.12859 WP_000615767.1.12898 WP_000615767.1.12905 WP_000615767.1.12928 WP_000615767.1.12942 WP_000615767.1.12948 WP_000615767.1.12958 WP_000615767.1.12963 WP_000615767.1.12985 WP_000615767.1.12996 WP_000615767.1.13000 WP_000615767.1.1302 WP_000615767.1.1303 WP_000615767.1.13032 WP_000615767.1.13033 WP_000615767.1.13035 WP_000615767.1.13048 WP_000615767.1.13058 WP_000615767.1.13065 WP_000615767.1.13067 WP_000615767.1.13099 WP_000615767.1.13100 WP_000615767.1.13121 WP_000615767.1.13140 WP_000615767.1.13168 WP_000615767.1.13209 WP_000615767.1.13229 WP_000615767.1.13257 WP_000615767.1.13276 WP_000615767.1.1329 WP_000615767.1.1330 WP_000615767.1.13305 WP_000615767.1.1332 WP_000615767.1.13324 WP_000615767.1.13327 WP_000615767.1.13331 WP_000615767.1.13340 WP_000615767.1.13363 WP_000615767.1.13382 WP_000615767.1.13388 WP_000615767.1.13390 WP_000615767.1.13402 WP_000615767.1.13410 WP_000615767.1.13455 WP_000615767.1.135 WP_000615767.1.13515 WP_000615767.1.13527 WP_000615767.1.13560 WP_000615767.1.13565 WP_000615767.1.13570 WP_000615767.1.13581 WP_000615767.1.13584 WP_000615767.1.13606 WP_000615767.1.13607 WP_000615767.1.13629 WP_000615767.1.13643 WP_000615767.1.13653 WP_000615767.1.1368 WP_000615767.1.13692 WP_000615767.1.13701 WP_000615767.1.13705 WP_000615767.1.1371 WP_000615767.1.13710 WP_000615767.1.13736 WP_000615767.1.13830 WP_000615767.1.13845 WP_000615767.1.13873 WP_000615767.1.139 WP_000615767.1.1391 WP_000615767.1.13917 WP_000615767.1.13954 WP_000615767.1.13958 WP_000615767.1.13960 WP_000615767.1.13989 WP_000615767.1.1399 WP_000615767.1.13997 WP_000615767.1.14002 WP_000615767.1.14033 WP_000615767.1.14051 WP_000615767.1.14066 WP_000615767.1.14077 WP_000615767.1.14102 WP_000615767.1.14106 WP_000615767.1.14107 WP_000615767.1.14132 WP_000615767.1.14166 WP_000615767.1.14206 WP_000615767.1.14211 WP_000615767.1.14218 WP_000615767.1.14254 WP_000615767.1.14258 WP_000615767.1.14287 WP_000615767.1.14291 WP_000615767.1.14294 WP_000615767.1.14327 WP_000615767.1.14350 WP_000615767.1.14384 WP_000615767.1.14408 WP_000615767.1.14409 WP_000615767.1.14480 WP_000615767.1.14488 WP_000615767.1.145 WP_000615767.1.14511 WP_000615767.1.14513 WP_000615767.1.14534 WP_000615767.1.14541 WP_000615767.1.14560 WP_000615767.1.14578 WP_000615767.1.14662 WP_000615767.1.14663 WP_000615767.1.14682 WP_000615767.1.14779 WP_000615767.1.14780 WP_000615767.1.14784 WP_000615767.1.14831 WP_000615767.1.14880 WP_000615767.1.14899 WP_000615767.1.14957 WP_000615767.1.14959 WP_000615767.1.14975 WP_000615767.1.14983 WP_000615767.1.15018 WP_000615767.1.1502 WP_000615767.1.1503 WP_000615767.1.15030 WP_000615767.1.1507 WP_000615767.1.15106 WP_000615767.1.15113 WP_000615767.1.15139 WP_000615767.1.15141 WP_000615767.1.15142 WP_000615767.1.15149 WP_000615767.1.15162 WP_000615767.1.15189 WP_000615767.1.15220 WP_000615767.1.15366 WP_000615767.1.15370 WP_000615767.1.15390 WP_000615767.1.15395 WP_000615767.1.15396 WP_000615767.1.1541 WP_000615767.1.15425 WP_000615767.1.15440 WP_000615767.1.15498 WP_000615767.1.15504 WP_000615767.1.15506 WP_000615767.1.15509 WP_000615767.1.15513 WP_000615767.1.15542 WP_000615767.1.15575 WP_000615767.1.15578 WP_000615767.1.15588 WP_000615767.1.15596 WP_000615767.1.15607 WP_000615767.1.15635 WP_000615767.1.15639 WP_000615767.1.15648 WP_000615767.1.15650 WP_000615767.1.15661 WP_000615767.1.15670 WP_000615767.1.15671 WP_000615767.1.15683 WP_000615767.1.15690 WP_000615767.1.15720 WP_000615767.1.15759 WP_000615767.1.15787 WP_000615767.1.15788 WP_000615767.1.15798 WP_000615767.1.1584 WP_000615767.1.15849 WP_000615767.1.15891 WP_000615767.1.15900 WP_000615767.1.15907 WP_000615767.1.15918 WP_000615767.1.15935 WP_000615767.1.15965 WP_000615767.1.16049 WP_000615767.1.16064 WP_000615767.1.16081 WP_000615767.1.16093 WP_000615767.1.16094 WP_000615767.1.16099 WP_000615767.1.16118 WP_000615767.1.16152 WP_000615767.1.16181 WP_000615767.1.16184 WP_000615767.1.16218 WP_000615767.1.16229 WP_000615767.1.16240 WP_000615767.1.16259 WP_000615767.1.16281 WP_000615767.1.16282 WP_000615767.1.16287 WP_000615767.1.16323 WP_000615767.1.16330 WP_000615767.1.16337 WP_000615767.1.16381 WP_000615767.1.16385 WP_000615767.1.16404 WP_000615767.1.16509 WP_000615767.1.16514 WP_000615767.1.16527 WP_000615767.1.1653 WP_000615767.1.16543 WP_000615767.1.16555 WP_000615767.1.16630 WP_000615767.1.16676 WP_000615767.1.16727 WP_000615767.1.16730 WP_000615767.1.16741 WP_000615767.1.16778 WP_000615767.1.16793 WP_000615767.1.168 WP_000615767.1.16803 WP_000615767.1.16813 WP_000615767.1.16814 WP_000615767.1.1682 WP_000615767.1.16832 WP_000615767.1.16849 WP_000615767.1.1686 WP_000615767.1.16889 WP_000615767.1.16902 WP_000615767.1.16904 WP_000615767.1.16956 WP_000615767.1.1698 WP_000615767.1.17029 WP_000615767.1.17033 WP_000615767.1.17036 WP_000615767.1.17163 WP_000615767.1.17208 WP_000615767.1.17220 WP_000615767.1.17227 WP_000615767.1.17229 WP_000615767.1.1724 WP_000615767.1.17252 WP_000615767.1.17269 WP_000615767.1.17330 WP_000615767.1.17355 WP_000615767.1.17363 WP_000615767.1.1742 WP_000615767.1.17420 WP_000615767.1.17426 WP_000615767.1.17427 WP_000615767.1.17470 WP_000615767.1.17472 WP_000615767.1.17474 WP_000615767.1.17537 WP_000615767.1.17601 WP_000615767.1.17602 WP_000615767.1.17630 WP_000615767.1.17641 WP_000615767.1.17652 WP_000615767.1.17665 WP_000615767.1.17672 WP_000615767.1.17677 WP_000615767.1.17690 WP_000615767.1.17692 WP_000615767.1.17706 WP_000615767.1.17715 WP_000615767.1.17716 WP_000615767.1.17775 WP_000615767.1.17776 WP_000615767.1.17784 WP_000615767.1.17810 WP_000615767.1.17826 WP_000615767.1.1783 WP_000615767.1.17844 WP_000615767.1.17854 WP_000615767.1.17858 WP_000615767.1.17888 WP_000615767.1.17895 WP_000615767.1.17917 WP_000615767.1.17933 WP_000615767.1.17954 WP_000615767.1.17971 WP_000615767.1.18012 WP_000615767.1.18081 WP_000615767.1.18127 WP_000615767.1.18130 WP_000615767.1.18131 WP_000615767.1.18180 WP_000615767.1.18233 WP_000615767.1.18236 WP_000615767.1.18258 WP_000615767.1.18266 WP_000615767.1.18278 WP_000615767.1.18279 WP_000615767.1.18300 WP_000615767.1.18361 WP_000615767.1.1839 WP_000615767.1.18404 WP_000615767.1.18415 WP_000615767.1.18423 WP_000615767.1.18457 WP_000615767.1.18464 WP_000615767.1.1848 WP_000615767.1.18496 WP_000615767.1.18534 WP_000615767.1.18571 WP_000615767.1.18630 WP_000615767.1.18644 WP_000615767.1.18652 WP_000615767.1.18670 WP_000615767.1.18712 WP_000615767.1.18733 WP_000615767.1.18764 WP_000615767.1.18770 WP_000615767.1.18831 WP_000615767.1.18869 WP_000615767.1.18884 WP_000615767.1.18903 WP_000615767.1.18920 WP_000615767.1.1894 WP_000615767.1.18955 WP_000615767.1.18985 WP_000615767.1.1899 WP_000615767.1.19010 WP_000615767.1.19015 WP_000615767.1.19045 WP_000615767.1.19103 WP_000615767.1.19162 WP_000615767.1.19166 WP_000615767.1.19172 WP_000615767.1.19184 WP_000615767.1.19190 WP_000615767.1.19201 WP_000615767.1.19216 WP_000615767.1.19218 WP_000615767.1.19236 WP_000615767.1.19237 WP_000615767.1.19267 WP_000615767.1.19275 WP_000615767.1.19368 WP_000615767.1.19383 WP_000615767.1.19385 WP_000615767.1.19392 WP_000615767.1.19420 WP_000615767.1.19470 WP_000615767.1.19493 WP_000615767.1.19513 WP_000615767.1.19527 WP_000615767.1.19530 WP_000615767.1.19532 WP_000615767.1.19558 WP_000615767.1.19559 WP_000615767.1.1956 WP_000615767.1.19603 WP_000615767.1.19631 WP_000615767.1.19698 WP_000615767.1.19719 WP_000615767.1.19730 WP_000615767.1.19754 WP_000615767.1.1983 WP_000615767.1.19832 WP_000615767.1.19837 WP_000615767.1.19856 WP_000615767.1.19880 WP_000615767.1.1996 WP_000615767.1.19961 WP_000615767.1.19965 WP_000615767.1.19995 WP_000615767.1.20011 WP_000615767.1.20015 WP_000615767.1.20041 WP_000615767.1.20045 WP_000615767.1.20079 WP_000615767.1.20108 WP_000615767.1.20110 WP_000615767.1.20149 WP_000615767.1.2017 WP_000615767.1.20185 WP_000615767.1.2019 WP_000615767.1.20209 WP_000615767.1.20274 WP_000615767.1.20279 WP_000615767.1.203 WP_000615767.1.2030 WP_000615767.1.20328 WP_000615767.1.20363 WP_000615767.1.20374 WP_000615767.1.20396 WP_000615767.1.20407 WP_000615767.1.20408 WP_000615767.1.20413 WP_000615767.1.20421 WP_000615767.1.20470 WP_000615767.1.2048 WP_000615767.1.20486 WP_000615767.1.20491 WP_000615767.1.20509 WP_000615767.1.20516 WP_000615767.1.20568 WP_000615767.1.2060 WP_000615767.1.20603 WP_000615767.1.20637 WP_000615767.1.20671 WP_000615767.1.20681 WP_000615767.1.20693 WP_000615767.1.20701 WP_000615767.1.20711 WP_000615767.1.20712 WP_000615767.1.20719 WP_000615767.1.2078 WP_000615767.1.20781 WP_000615767.1.20782 WP_000615767.1.20805 WP_000615767.1.20858 WP_000615767.1.20892 WP_000615767.1.20899 WP_000615767.1.20909 WP_000615767.1.20915 WP_000615767.1.20934 WP_000615767.1.20936 WP_000615767.1.20942 WP_000615767.1.20965 WP_000615767.1.20969 WP_000615767.1.20988 WP_000615767.1.21027 WP_000615767.1.21028 WP_000615767.1.21097 WP_000615767.1.21174 WP_000615767.1.21175 WP_000615767.1.21176 WP_000615767.1.21192 WP_000615767.1.21211 WP_000615767.1.21214 WP_000615767.1.21216 WP_000615767.1.21271 WP_000615767.1.213 WP_000615767.1.21329 WP_000615767.1.21331 WP_000615767.1.21355 WP_000615767.1.21370 WP_000615767.1.21381 WP_000615767.1.21421 WP_000615767.1.21422 WP_000615767.1.21433 WP_000615767.1.21435 WP_000615767.1.21436 WP_000615767.1.21452 WP_000615767.1.21472 WP_000615767.1.2148 WP_000615767.1.21495 WP_000615767.1.21507 WP_000615767.1.21518 WP_000615767.1.2152 WP_000615767.1.21605 WP_000615767.1.21610 WP_000615767.1.21612 WP_000615767.1.21620 WP_000615767.1.21642 WP_000615767.1.2167 WP_000615767.1.21682 WP_000615767.1.21684 WP_000615767.1.21699 WP_000615767.1.21701 WP_000615767.1.2173 WP_000615767.1.21753 WP_000615767.1.21780 WP_000615767.1.21788 WP_000615767.1.21806 WP_000615767.1.21816 WP_000615767.1.21822 WP_000615767.1.21885 WP_000615767.1.21949 WP_000615767.1.2197 WP_000615767.1.21979 WP_000615767.1.21990 WP_000615767.1.21997 WP_000615767.1.21998 WP_000615767.1.22014 WP_000615767.1.22016 WP_000615767.1.22035 WP_000615767.1.22043 WP_000615767.1.22057 WP_000615767.1.22061 WP_000615767.1.22122 WP_000615767.1.22124 WP_000615767.1.22135 WP_000615767.1.22146 WP_000615767.1.22201 WP_000615767.1.22262 WP_000615767.1.22263 WP_000615767.1.22271 WP_000615767.1.223 WP_000615767.1.22338 WP_000615767.1.22341 WP_000615767.1.22343 WP_000615767.1.22392 WP_000615767.1.22397 WP_000615767.1.22422 WP_000615767.1.22439 WP_000615767.1.22457 WP_000615767.1.22459 WP_000615767.1.22480 WP_000615767.1.22497 WP_000615767.1.22505 WP_000615767.1.22513 WP_000615767.1.22546 WP_000615767.1.2255 WP_000615767.1.22550 WP_000615767.1.22561 WP_000615767.1.22596 WP_000615767.1.22612 WP_000615767.1.22636 WP_000615767.1.22637 WP_000615767.1.22638 WP_000615767.1.22643 WP_000615767.1.22675 WP_000615767.1.22720 WP_000615767.1.22723 WP_000615767.1.22751 WP_000615767.1.22763 WP_000615767.1.22772 WP_000615767.1.22784 WP_000615767.1.22791 WP_000615767.1.22897 WP_000615767.1.22904 WP_000615767.1.22914 WP_000615767.1.22938 WP_000615767.1.2295 WP_000615767.1.22955 WP_000615767.1.2297 WP_000615767.1.22976 WP_000615767.1.23016 WP_000615767.1.23025 WP_000615767.1.23031 WP_000615767.1.23043 WP_000615767.1.23066 WP_000615767.1.23083 WP_000615767.1.23097 WP_000615767.1.2310 WP_000615767.1.23107 WP_000615767.1.2311 WP_000615767.1.23111 WP_000615767.1.23177 WP_000615767.1.23178 WP_000615767.1.23180 WP_000615767.1.23256 WP_000615767.1.23313 WP_000615767.1.23320 WP_000615767.1.23326 WP_000615767.1.23332 WP_000615767.1.23334 WP_000615767.1.23397 WP_000615767.1.23477 WP_000615767.1.23481 WP_000615767.1.23597 WP_000615767.1.23600 WP_000615767.1.23602 WP_000615767.1.23606 WP_000615767.1.23620 WP_000615767.1.23633 WP_000615767.1.23635 WP_000615767.1.23656 WP_000615767.1.23659 WP_000615767.1.23722 WP_000615767.1.23742 WP_000615767.1.23770 WP_000615767.1.23791 WP_000615767.1.23853 WP_000615767.1.23889 WP_000615767.1.239 WP_000615767.1.23912 WP_000615767.1.23916 WP_000615767.1.23930 WP_000615767.1.23966 WP_000615767.1.23968 WP_000615767.1.23988 WP_000615767.1.24040 WP_000615767.1.24060 WP_000615767.1.24067 WP_000615767.1.24094 WP_000615767.1.24102 WP_000615767.1.24164 WP_000615767.1.24232 WP_000615767.1.24252 WP_000615767.1.24262 WP_000615767.1.24281 WP_000615767.1.24288 WP_000615767.1.243 WP_000615767.1.24312 WP_000615767.1.24318 WP_000615767.1.24324 WP_000615767.1.24379 WP_000615767.1.24384 WP_000615767.1.24401 WP_000615767.1.24440 WP_000615767.1.24467 WP_000615767.1.24471 WP_000615767.1.24497 WP_000615767.1.24540 WP_000615767.1.24542 WP_000615767.1.24552 WP_000615767.1.24571 WP_000615767.1.24573 WP_000615767.1.2459 WP_000615767.1.24598 WP_000615767.1.2461 WP_000615767.1.24620 WP_000615767.1.24627 WP_000615767.1.2465 WP_000615767.1.24658 WP_000615767.1.24677 WP_000615767.1.24772 WP_000615767.1.24788 WP_000615767.1.24825 WP_000615767.1.24835 WP_000615767.1.24852 WP_000615767.1.24861 WP_000615767.1.24874 WP_000615767.1.249 WP_000615767.1.24928 WP_000615767.1.24943 WP_000615767.1.24947 WP_000615767.1.24989 WP_000615767.1.25005 WP_000615767.1.2503 WP_000615767.1.25106 WP_000615767.1.25121 WP_000615767.1.25124 WP_000615767.1.25132 WP_000615767.1.252 WP_000615767.1.25222 WP_000615767.1.25226 WP_000615767.1.25244 WP_000615767.1.25264 WP_000615767.1.2533 WP_000615767.1.25351 WP_000615767.1.2538 WP_000615767.1.25383 WP_000615767.1.25432 WP_000615767.1.25439 WP_000615767.1.25442 WP_000615767.1.25461 WP_000615767.1.2548 WP_000615767.1.25483 WP_000615767.1.25494 WP_000615767.1.25502 WP_000615767.1.25545 WP_000615767.1.25553 WP_000615767.1.2556 WP_000615767.1.25571 WP_000615767.1.25624 WP_000615767.1.25660 WP_000615767.1.25684 WP_000615767.1.25696 WP_000615767.1.25714 WP_000615767.1.25742 WP_000615767.1.25754 WP_000615767.1.25767 WP_000615767.1.25768 WP_000615767.1.25785 WP_000615767.1.2586 WP_000615767.1.25880 WP_000615767.1.25883 WP_000615767.1.25897 WP_000615767.1.25905 WP_000615767.1.25909 WP_000615767.1.25952 WP_000615767.1.25982 WP_000615767.1.26021 WP_000615767.1.26041 WP_000615767.1.26059 WP_000615767.1.2607 WP_000615767.1.26078 WP_000615767.1.2610 WP_000615767.1.26112 WP_000615767.1.26165 WP_000615767.1.26180 WP_000615767.1.26218 WP_000615767.1.26220 WP_000615767.1.26279 WP_000615767.1.26280 WP_000615767.1.2629 WP_000615767.1.26317 WP_000615767.1.26344 WP_000615767.1.26371 WP_000615767.1.26389 WP_000615767.1.26392 WP_000615767.1.26413 WP_000615767.1.26447 WP_000615767.1.2647 WP_000615767.1.26470 WP_000615767.1.26490 WP_000615767.1.26496 WP_000615767.1.26497 WP_000615767.1.26578 WP_000615767.1.26653 WP_000615767.1.26698 WP_000615767.1.26725 WP_000615767.1.26781 WP_000615767.1.26783 WP_000615767.1.26799 WP_000615767.1.26823 WP_000615767.1.26848 WP_000615767.1.26855 WP_000615767.1.26879 WP_000615767.1.26900 WP_000615767.1.26901 WP_000615767.1.26910 WP_000615767.1.26918 WP_000615767.1.26926 WP_000615767.1.26988 WP_000615767.1.26990 WP_000615767.1.27022 WP_000615767.1.2703 WP_000615767.1.27046 WP_000615767.1.27076 WP_000615767.1.27119 WP_000615767.1.27131 WP_000615767.1.27151 WP_000615767.1.27203 WP_000615767.1.2721 WP_000615767.1.27210 WP_000615767.1.27219 WP_000615767.1.2724 WP_000615767.1.27249 WP_000615767.1.27252 WP_000615767.1.2729 WP_000615767.1.27308 WP_000615767.1.27312 WP_000615767.1.27324 WP_000615767.1.27347 WP_000615767.1.2735 WP_000615767.1.27392 WP_000615767.1.27394 WP_000615767.1.27405 WP_000615767.1.27421 WP_000615767.1.27428 WP_000615767.1.27432 WP_000615767.1.27478 WP_000615767.1.27479 WP_000615767.1.2750 WP_000615767.1.27514 WP_000615767.1.2752 WP_000615767.1.27581 WP_000615767.1.276 WP_000615767.1.27601 WP_000615767.1.27610 WP_000615767.1.27636 WP_000615767.1.27653 WP_000615767.1.27661 WP_000615767.1.27690 WP_000615767.1.27721 WP_000615767.1.27740 WP_000615767.1.27759 WP_000615767.1.27789 WP_000615767.1.27808 WP_000615767.1.27829 WP_000615767.1.27853 WP_000615767.1.2786 WP_000615767.1.27862 WP_000615767.1.27866 WP_000615767.1.27868 WP_000615767.1.27886 WP_000615767.1.27887 WP_000615767.1.27904 WP_000615767.1.27907 WP_000615767.1.2791 WP_000615767.1.27984 WP_000615767.1.280 WP_000615767.1.28014 WP_000615767.1.28028 WP_000615767.1.28050 WP_000615767.1.28058 WP_000615767.1.28068 WP_000615767.1.28069 WP_000615767.1.28089 WP_000615767.1.28104 WP_000615767.1.28151 WP_000615767.1.28164 WP_000615767.1.28180 WP_000615767.1.28183 WP_000615767.1.28228 WP_000615767.1.28248 WP_000615767.1.2827 WP_000615767.1.28296 WP_000615767.1.2830 WP_000615767.1.28350 WP_000615767.1.28351 WP_000615767.1.28379 WP_000615767.1.28450 WP_000615767.1.28458 WP_000615767.1.28519 WP_000615767.1.28524 WP_000615767.1.28537 WP_000615767.1.28542 WP_000615767.1.28549 WP_000615767.1.28572 WP_000615767.1.28589 WP_000615767.1.28604 WP_000615767.1.28659 WP_000615767.1.28680 WP_000615767.1.28714 WP_000615767.1.28746 WP_000615767.1.28767 WP_000615767.1.28771 WP_000615767.1.28790 WP_000615767.1.28816 WP_000615767.1.2882 WP_000615767.1.28846 WP_000615767.1.28867 WP_000615767.1.28868 WP_000615767.1.28869 WP_000615767.1.28892 WP_000615767.1.28945 WP_000615767.1.28956 WP_000615767.1.28986 WP_000615767.1.28997 WP_000615767.1.29018 WP_000615767.1.29046 WP_000615767.1.29076 WP_000615767.1.2909 WP_000615767.1.29104 WP_000615767.1.29105 WP_000615767.1.2911 WP_000615767.1.29151 WP_000615767.1.29192 WP_000615767.1.292 WP_000615767.1.29205 WP_000615767.1.2922 WP_000615767.1.29232 WP_000615767.1.29253 WP_000615767.1.29266 WP_000615767.1.29269 WP_000615767.1.29280 WP_000615767.1.29284 WP_000615767.1.29286 WP_000615767.1.29289 WP_000615767.1.29300 WP_000615767.1.29311 WP_000615767.1.29343 WP_000615767.1.29351 WP_000615767.1.29357 WP_000615767.1.29360 WP_000615767.1.2940 WP_000615767.1.29406 WP_000615767.1.29442 WP_000615767.1.29469 WP_000615767.1.29473 WP_000615767.1.295 WP_000615767.1.29517 WP_000615767.1.29536 WP_000615767.1.29642 WP_000615767.1.29653 WP_000615767.1.2966 WP_000615767.1.29687 WP_000615767.1.29694 WP_000615767.1.2970 WP_000615767.1.29702 WP_000615767.1.29712 WP_000615767.1.29734 WP_000615767.1.29751 WP_000615767.1.29828 WP_000615767.1.29852 WP_000615767.1.29868 WP_000615767.1.29881 WP_000615767.1.29894 WP_000615767.1.29921 WP_000615767.1.29944 WP_000615767.1.29951 WP_000615767.1.29980 WP_000615767.1.30011 WP_000615767.1.30066 WP_000615767.1.3008 WP_000615767.1.3011 WP_000615767.1.30119 WP_000615767.1.30133 WP_000615767.1.30134 WP_000615767.1.30142 WP_000615767.1.30199 WP_000615767.1.30205 WP_000615767.1.30219 WP_000615767.1.30229 WP_000615767.1.30233 WP_000615767.1.30245 WP_000615767.1.30255 WP_000615767.1.30290 WP_000615767.1.30295 WP_000615767.1.30301 WP_000615767.1.30316 WP_000615767.1.30342 WP_000615767.1.30384 WP_000615767.1.30387 WP_000615767.1.30406 WP_000615767.1.30435 WP_000615767.1.30480 WP_000615767.1.30487 WP_000615767.1.30514 WP_000615767.1.30515 WP_000615767.1.30538 WP_000615767.1.30543 WP_000615767.1.30549 WP_000615767.1.30553 WP_000615767.1.30588 WP_000615767.1.30591 WP_000615767.1.30607 WP_000615767.1.30612 WP_000615767.1.30672 WP_000615767.1.30711 WP_000615767.1.30724 WP_000615767.1.30784 WP_000615767.1.30864 WP_000615767.1.30891 WP_000615767.1.30933 WP_000615767.1.30948 WP_000615767.1.30959 WP_000615767.1.30964 WP_000615767.1.30982 WP_000615767.1.30984 WP_000615767.1.31006 WP_000615767.1.3105 WP_000615767.1.31057 WP_000615767.1.31082 WP_000615767.1.31099 WP_000615767.1.31134 WP_000615767.1.31164 WP_000615767.1.31169 WP_000615767.1.31216 WP_000615767.1.31256 WP_000615767.1.31275 WP_000615767.1.31276 WP_000615767.1.31322 WP_000615767.1.3133 WP_000615767.1.31367 WP_000615767.1.31383 WP_000615767.1.31394 WP_000615767.1.31427 WP_000615767.1.31439 WP_000615767.1.31466 WP_000615767.1.31473 WP_000615767.1.31488 WP_000615767.1.3152 WP_000615767.1.31528 WP_000615767.1.31550 WP_000615767.1.31553 WP_000615767.1.3156 WP_000615767.1.31603 WP_000615767.1.3161 WP_000615767.1.31619 WP_000615767.1.31620 WP_000615767.1.31650 WP_000615767.1.31651 WP_000615767.1.31688 WP_000615767.1.31695 WP_000615767.1.31705 WP_000615767.1.31735 WP_000615767.1.31759 WP_000615767.1.31859 WP_000615767.1.31876 WP_000615767.1.31887 WP_000615767.1.3191 WP_000615767.1.31912 WP_000615767.1.31929 WP_000615767.1.31935 WP_000615767.1.31945 WP_000615767.1.31974 WP_000615767.1.31975 WP_000615767.1.31979 WP_000615767.1.320 WP_000615767.1.32068 WP_000615767.1.32080 WP_000615767.1.32084 WP_000615767.1.32097 WP_000615767.1.32110 WP_000615767.1.32117 WP_000615767.1.32128 WP_000615767.1.32139 WP_000615767.1.32171 WP_000615767.1.32187 WP_000615767.1.3221 WP_000615767.1.32261 WP_000615767.1.32280 WP_000615767.1.32282 WP_000615767.1.32288 WP_000615767.1.32296 WP_000615767.1.32303 WP_000615767.1.32344 WP_000615767.1.32351 WP_000615767.1.32362 WP_000615767.1.32389 WP_000615767.1.32391 WP_000615767.1.32413 WP_000615767.1.32462 WP_000615767.1.32469 WP_000615767.1.32485 WP_000615767.1.32507 WP_000615767.1.32540 WP_000615767.1.3255 WP_000615767.1.32550 WP_000615767.1.32567 WP_000615767.1.32604 WP_000615767.1.32606 WP_000615767.1.32642 WP_000615767.1.32688 WP_000615767.1.32689 WP_000615767.1.32696 WP_000615767.1.32701 WP_000615767.1.32717 WP_000615767.1.32719 WP_000615767.1.32734 WP_000615767.1.32768 WP_000615767.1.32774 WP_000615767.1.32794 WP_000615767.1.32807 WP_000615767.1.32808 WP_000615767.1.32816 WP_000615767.1.32820 WP_000615767.1.32850 WP_000615767.1.32876 WP_000615767.1.32877 WP_000615767.1.32892 WP_000615767.1.32949 WP_000615767.1.32950 WP_000615767.1.32994 WP_000615767.1.33005 WP_000615767.1.33013 WP_000615767.1.33021 WP_000615767.1.33034 WP_000615767.1.33071 WP_000615767.1.33073 WP_000615767.1.33113 WP_000615767.1.33128 WP_000615767.1.33159 WP_000615767.1.33166 WP_000615767.1.33181 WP_000615767.1.33286 WP_000615767.1.33291 WP_000615767.1.33312 WP_000615767.1.33348 WP_000615767.1.33354 WP_000615767.1.33359 WP_000615767.1.33361 WP_000615767.1.33415 WP_000615767.1.33430 WP_000615767.1.33433 WP_000615767.1.33454 WP_000615767.1.33458 WP_000615767.1.33482 WP_000615767.1.33527 WP_000615767.1.33570 WP_000615767.1.33598 WP_000615767.1.33606 WP_000615767.1.33634 WP_000615767.1.33637 WP_000615767.1.33647 WP_000615767.1.33666 WP_000615767.1.33719 WP_000615767.1.33727 WP_000615767.1.33749 WP_000615767.1.3375 WP_000615767.1.33781 WP_000615767.1.33807 WP_000615767.1.33862 WP_000615767.1.33874 WP_000615767.1.33881 WP_000615767.1.33923 WP_000615767.1.33950 WP_000615767.1.33956 WP_000615767.1.33960 WP_000615767.1.3400 WP_000615767.1.34015 WP_000615767.1.34041 WP_000615767.1.34074 WP_000615767.1.34085 WP_000615767.1.3409 WP_000615767.1.34097 WP_000615767.1.34120 WP_000615767.1.34162 WP_000615767.1.34171 WP_000615767.1.34176 WP_000615767.1.34196 WP_000615767.1.34262 WP_000615767.1.34272 WP_000615767.1.34291 WP_000615767.1.34297 WP_000615767.1.34301 WP_000615767.1.34309 WP_000615767.1.3433 WP_000615767.1.34335 WP_000615767.1.3437 WP_000615767.1.34449 WP_000615767.1.34466 WP_000615767.1.34485 WP_000615767.1.34503 WP_000615767.1.34506 WP_000615767.1.34508 WP_000615767.1.34519 WP_000615767.1.34522 WP_000615767.1.34548 WP_000615767.1.34559 WP_000615767.1.3458 WP_000615767.1.34601 WP_000615767.1.34616 WP_000615767.1.34644 WP_000615767.1.34662 WP_000615767.1.34674 WP_000615767.1.34690 WP_000615767.1.34699 WP_000615767.1.34719 WP_000615767.1.34739 WP_000615767.1.34742 WP_000615767.1.34746 WP_000615767.1.34776 WP_000615767.1.34785 WP_000615767.1.34787 WP_000615767.1.34792 WP_000615767.1.34809 WP_000615767.1.34839 WP_000615767.1.3486 WP_000615767.1.34886 WP_000615767.1.3494 WP_000615767.1.3496 WP_000615767.1.34995 WP_000615767.1.35042 WP_000615767.1.3505 WP_000615767.1.35064 WP_000615767.1.35076 WP_000615767.1.35098 WP_000615767.1.35103 WP_000615767.1.35117 WP_000615767.1.35124 WP_000615767.1.35151 WP_000615767.1.35152 WP_000615767.1.35217 WP_000615767.1.35232 WP_000615767.1.35239 WP_000615767.1.35247 WP_000615767.1.35248 WP_000615767.1.35251 WP_000615767.1.35290 WP_000615767.1.3530 WP_000615767.1.35305 WP_000615767.1.3532 WP_000615767.1.35358 WP_000615767.1.3537 WP_000615767.1.35380 WP_000615767.1.35383 WP_000615767.1.35392 WP_000615767.1.35411 WP_000615767.1.35447 WP_000615767.1.35459 WP_000615767.1.35482 WP_000615767.1.35501 WP_000615767.1.35521 WP_000615767.1.35528 WP_000615767.1.35541 WP_000615767.1.35597 WP_000615767.1.356 WP_000615767.1.35655 WP_000615767.1.35665 WP_000615767.1.35702 WP_000615767.1.35708 WP_000615767.1.3571 WP_000615767.1.35721 WP_000615767.1.35727 WP_000615767.1.35735 WP_000615767.1.35743 WP_000615767.1.35834 WP_000615767.1.35836 WP_000615767.1.35851 WP_000615767.1.35875 WP_000615767.1.3589 WP_000615767.1.35905 WP_000615767.1.35919 WP_000615767.1.35925 WP_000615767.1.35932 WP_000615767.1.35957 WP_000615767.1.35960 WP_000615767.1.3597 WP_000615767.1.35972 WP_000615767.1.35974 WP_000615767.1.35981 WP_000615767.1.36054 WP_000615767.1.36060 WP_000615767.1.3608 WP_000615767.1.3609 WP_000615767.1.36109 WP_000615767.1.36124 WP_000615767.1.36131 WP_000615767.1.36144 WP_000615767.1.3616 WP_000615767.1.36160 WP_000615767.1.36167 WP_000615767.1.3618 WP_000615767.1.3621 WP_000615767.1.36230 WP_000615767.1.36242 WP_000615767.1.36247 WP_000615767.1.36317 WP_000615767.1.36330 WP_000615767.1.36351 WP_000615767.1.3638 WP_000615767.1.36382 WP_000615767.1.36391 WP_000615767.1.36404 WP_000615767.1.36429 WP_000615767.1.3646 WP_000615767.1.36463 WP_000615767.1.36476 WP_000615767.1.36479 WP_000615767.1.36510 WP_000615767.1.36546 WP_000615767.1.36552 WP_000615767.1.36554 WP_000615767.1.36591 WP_000615767.1.36731 WP_000615767.1.36732 WP_000615767.1.36741 WP_000615767.1.36750 WP_000615767.1.36762 WP_000615767.1.36772 WP_000615767.1.36803 WP_000615767.1.36972 WP_000615767.1.36992 WP_000615767.1.36993 WP_000615767.1.36994 WP_000615767.1.37033 WP_000615767.1.37062 WP_000615767.1.37115 WP_000615767.1.37118 WP_000615767.1.37136 WP_000615767.1.37138 WP_000615767.1.37142 WP_000615767.1.37154 WP_000615767.1.37156 WP_000615767.1.37164 WP_000615767.1.37166 WP_000615767.1.37170 WP_000615767.1.37205 WP_000615767.1.37209 WP_000615767.1.37250 WP_000615767.1.37289 WP_000615767.1.37294 WP_000615767.1.37300 WP_000615767.1.37310 WP_000615767.1.37346 WP_000615767.1.37443 WP_000615767.1.37450 WP_000615767.1.37458 WP_000615767.1.37479 WP_000615767.1.37522 WP_000615767.1.37526 WP_000615767.1.37541 WP_000615767.1.37575 WP_000615767.1.37629 WP_000615767.1.3763 WP_000615767.1.37658 WP_000615767.1.37696 WP_000615767.1.37713 WP_000615767.1.37714 WP_000615767.1.37746 WP_000615767.1.37767 WP_000615767.1.3780 WP_000615767.1.37837 WP_000615767.1.37840 WP_000615767.1.37854 WP_000615767.1.37876 WP_000615767.1.37883 WP_000615767.1.37921 WP_000615767.1.37947 WP_000615767.1.37989 WP_000615767.1.38014 WP_000615767.1.38024 WP_000615767.1.38029 WP_000615767.1.38073 WP_000615767.1.38170 WP_000615767.1.38184 WP_000615767.1.38213 WP_000615767.1.38216 WP_000615767.1.38220 WP_000615767.1.38275 WP_000615767.1.38283 WP_000615767.1.38294 WP_000615767.1.3830 WP_000615767.1.38355 WP_000615767.1.38374 WP_000615767.1.38378 WP_000615767.1.3844 WP_000615767.1.38459 WP_000615767.1.38503 WP_000615767.1.38506 WP_000615767.1.38521 WP_000615767.1.38527 WP_000615767.1.38542 WP_000615767.1.38543 WP_000615767.1.38602 WP_000615767.1.38605 WP_000615767.1.38624 WP_000615767.1.3864 WP_000615767.1.38647 WP_000615767.1.38675 WP_000615767.1.38676 WP_000615767.1.387 WP_000615767.1.38708 WP_000615767.1.38718 WP_000615767.1.38723 WP_000615767.1.38738 WP_000615767.1.3877 WP_000615767.1.38770 WP_000615767.1.38796 WP_000615767.1.38805 WP_000615767.1.38840 WP_000615767.1.38855 WP_000615767.1.38860 WP_000615767.1.38868 WP_000615767.1.38892 WP_000615767.1.38949 WP_000615767.1.38955 WP_000615767.1.3897 WP_000615767.1.39006 WP_000615767.1.39051 WP_000615767.1.39076 WP_000615767.1.39079 WP_000615767.1.39087 WP_000615767.1.39091 WP_000615767.1.39093 WP_000615767.1.39097 WP_000615767.1.39098 WP_000615767.1.39125 WP_000615767.1.39133 WP_000615767.1.39139 WP_000615767.1.39151 WP_000615767.1.3917 WP_000615767.1.39192 WP_000615767.1.39198 WP_000615767.1.392 WP_000615767.1.39227 WP_000615767.1.39243 WP_000615767.1.3928 WP_000615767.1.39292 WP_000615767.1.39304 WP_000615767.1.3932 WP_000615767.1.39320 WP_000615767.1.39321 WP_000615767.1.39322 WP_000615767.1.39336 WP_000615767.1.39337 WP_000615767.1.39343 WP_000615767.1.39387 WP_000615767.1.3939 WP_000615767.1.39394 WP_000615767.1.39412 WP_000615767.1.39421 WP_000615767.1.39453 WP_000615767.1.39454 WP_000615767.1.39479 WP_000615767.1.395 WP_000615767.1.39505 WP_000615767.1.39518 WP_000615767.1.39533 WP_000615767.1.39558 WP_000615767.1.39585 WP_000615767.1.39591 WP_000615767.1.39597 WP_000615767.1.3966 WP_000615767.1.39663 WP_000615767.1.39710 WP_000615767.1.39719 WP_000615767.1.39793 WP_000615767.1.39828 WP_000615767.1.39845 WP_000615767.1.39865 WP_000615767.1.39866 WP_000615767.1.39872 WP_000615767.1.39931 WP_000615767.1.39948 WP_000615767.1.39964 WP_000615767.1.39985 WP_000615767.1.39990 WP_000615767.1.400 WP_000615767.1.40005 WP_000615767.1.40007 WP_000615767.1.40018 WP_000615767.1.40023 WP_000615767.1.40027 WP_000615767.1.40041 WP_000615767.1.40092 WP_000615767.1.40106 WP_000615767.1.40112 WP_000615767.1.40122 WP_000615767.1.40128 WP_000615767.1.40182 WP_000615767.1.40216 WP_000615767.1.40239 WP_000615767.1.40251 WP_000615767.1.40269 WP_000615767.1.40296 WP_000615767.1.40303 WP_000615767.1.40306 WP_000615767.1.40362 WP_000615767.1.40376 WP_000615767.1.40393 WP_000615767.1.40422 WP_000615767.1.40434 WP_000615767.1.4044 WP_000615767.1.40457 WP_000615767.1.40515 WP_000615767.1.40526 WP_000615767.1.40558 WP_000615767.1.40566 WP_000615767.1.40568 WP_000615767.1.4059 WP_000615767.1.40602 WP_000615767.1.40626 WP_000615767.1.40642 WP_000615767.1.40682 WP_000615767.1.4070 WP_000615767.1.40726 WP_000615767.1.40728 WP_000615767.1.4073 WP_000615767.1.40730 WP_000615767.1.40733 WP_000615767.1.40737 WP_000615767.1.40767 WP_000615767.1.40801 WP_000615767.1.4084 WP_000615767.1.40850 WP_000615767.1.40889 WP_000615767.1.40928 WP_000615767.1.40931 WP_000615767.1.4094 WP_000615767.1.40958 WP_000615767.1.40960 WP_000615767.1.40968 WP_000615767.1.40977 WP_000615767.1.40982 WP_000615767.1.40985 WP_000615767.1.40986 WP_000615767.1.41010 WP_000615767.1.41019 WP_000615767.1.41025 WP_000615767.1.41043 WP_000615767.1.41047 WP_000615767.1.41068 WP_000615767.1.41088 WP_000615767.1.4111 WP_000615767.1.41126 WP_000615767.1.4117 WP_000615767.1.41186 WP_000615767.1.41203 WP_000615767.1.41209 WP_000615767.1.41267 WP_000615767.1.41275 WP_000615767.1.41309 WP_000615767.1.41317 WP_000615767.1.41327 WP_000615767.1.4133 WP_000615767.1.41360 WP_000615767.1.41366 WP_000615767.1.41369 WP_000615767.1.4143 WP_000615767.1.41450 WP_000615767.1.41467 WP_000615767.1.41475 WP_000615767.1.41476 WP_000615767.1.41523 WP_000615767.1.41551 WP_000615767.1.41586 WP_000615767.1.4159 WP_000615767.1.41594 WP_000615767.1.41673 WP_000615767.1.41709 WP_000615767.1.41739 WP_000615767.1.41763 WP_000615767.1.41801 WP_000615767.1.41808 WP_000615767.1.41811 WP_000615767.1.41823 WP_000615767.1.41850 WP_000615767.1.41858 WP_000615767.1.41892 WP_000615767.1.41902 WP_000615767.1.41914 WP_000615767.1.41927 WP_000615767.1.41932 WP_000615767.1.41952 WP_000615767.1.41986 WP_000615767.1.4201 WP_000615767.1.42024 WP_000615767.1.42034 WP_000615767.1.42058 WP_000615767.1.42076 WP_000615767.1.42099 WP_000615767.1.42100 WP_000615767.1.42140 WP_000615767.1.42195 WP_000615767.1.42199 WP_000615767.1.42204 WP_000615767.1.42229 WP_000615767.1.42232 WP_000615767.1.42234 WP_000615767.1.42245 WP_000615767.1.4230 WP_000615767.1.4238 WP_000615767.1.42386 WP_000615767.1.42450 WP_000615767.1.4249 WP_000615767.1.4252 WP_000615767.1.42546 WP_000615767.1.42566 WP_000615767.1.42611 WP_000615767.1.42642 WP_000615767.1.42654 WP_000615767.1.42743 WP_000615767.1.42760 WP_000615767.1.42792 WP_000615767.1.42807 WP_000615767.1.42817 WP_000615767.1.42873 WP_000615767.1.42933 WP_000615767.1.42935 WP_000615767.1.42960 WP_000615767.1.42965 WP_000615767.1.43012 WP_000615767.1.43015 WP_000615767.1.43029 WP_000615767.1.43044 WP_000615767.1.43045 WP_000615767.1.43046 WP_000615767.1.43059 WP_000615767.1.4307 WP_000615767.1.43074 WP_000615767.1.43085 WP_000615767.1.43119 WP_000615767.1.4317 WP_000615767.1.43186 WP_000615767.1.43191 WP_000615767.1.43219 WP_000615767.1.4328 WP_000615767.1.43289 WP_000615767.1.43302 WP_000615767.1.43329 WP_000615767.1.43343 WP_000615767.1.43344 WP_000615767.1.43361 WP_000615767.1.43367 WP_000615767.1.43377 WP_000615767.1.43390 WP_000615767.1.4340 WP_000615767.1.43408 WP_000615767.1.43423 WP_000615767.1.43424 WP_000615767.1.43426 WP_000615767.1.43464 WP_000615767.1.43467 WP_000615767.1.43479 WP_000615767.1.43516 WP_000615767.1.43529 WP_000615767.1.43584 WP_000615767.1.43634 WP_000615767.1.4364 WP_000615767.1.43644 WP_000615767.1.43658 WP_000615767.1.43661 WP_000615767.1.43698 WP_000615767.1.43701 WP_000615767.1.43741 WP_000615767.1.43744 WP_000615767.1.43753 WP_000615767.1.43771 WP_000615767.1.43774 WP_000615767.1.43775 WP_000615767.1.43792 WP_000615767.1.43793 WP_000615767.1.43845 WP_000615767.1.43870 WP_000615767.1.43889 WP_000615767.1.43900 WP_000615767.1.43906 WP_000615767.1.43910 WP_000615767.1.43932 WP_000615767.1.43934 WP_000615767.1.43972 WP_000615767.1.44024 WP_000615767.1.44042 WP_000615767.1.44176 WP_000615767.1.44209 WP_000615767.1.44293 WP_000615767.1.44295 WP_000615767.1.44303 WP_000615767.1.4432 WP_000615767.1.44328 WP_000615767.1.44356 WP_000615767.1.44379 WP_000615767.1.44387 WP_000615767.1.44399 WP_000615767.1.44403 WP_000615767.1.4442 WP_000615767.1.44421 WP_000615767.1.44487 WP_000615767.1.44512 WP_000615767.1.44533 WP_000615767.1.44574 WP_000615767.1.44584 WP_000615767.1.44601 WP_000615767.1.4462 WP_000615767.1.44644 WP_000615767.1.44647 WP_000615767.1.44681 WP_000615767.1.44682 WP_000615767.1.44683 WP_000615767.1.44695 WP_000615767.1.44699 WP_000615767.1.44711 WP_000615767.1.44764 WP_000615767.1.44825 WP_000615767.1.44835 WP_000615767.1.44850 WP_000615767.1.44858 WP_000615767.1.44859 WP_000615767.1.44872 WP_000615767.1.44890 WP_000615767.1.4491 WP_000615767.1.44937 WP_000615767.1.44995 WP_000615767.1.45006 WP_000615767.1.45021 WP_000615767.1.45051 WP_000615767.1.45082 WP_000615767.1.45087 WP_000615767.1.451 WP_000615767.1.45118 WP_000615767.1.45179 WP_000615767.1.45187 WP_000615767.1.4525 WP_000615767.1.45357 WP_000615767.1.4536 WP_000615767.1.45370 WP_000615767.1.4543 WP_000615767.1.45433 WP_000615767.1.4547 WP_000615767.1.45476 WP_000615767.1.45528 WP_000615767.1.45531 WP_000615767.1.4554 WP_000615767.1.4556 WP_000615767.1.45601 WP_000615767.1.45612 WP_000615767.1.45639 WP_000615767.1.45688 WP_000615767.1.45691 WP_000615767.1.45746 WP_000615767.1.45749 WP_000615767.1.45753 WP_000615767.1.45762 WP_000615767.1.45825 WP_000615767.1.45843 WP_000615767.1.45905 WP_000615767.1.45917 WP_000615767.1.45927 WP_000615767.1.45952 WP_000615767.1.45993 WP_000615767.1.46012 WP_000615767.1.46022 WP_000615767.1.46024 WP_000615767.1.46044 WP_000615767.1.46074 WP_000615767.1.46094 WP_000615767.1.46149 WP_000615767.1.46155 WP_000615767.1.46156 WP_000615767.1.46158 WP_000615767.1.46166 WP_000615767.1.46191 WP_000615767.1.46206 WP_000615767.1.46251 WP_000615767.1.46270 WP_000615767.1.46281 WP_000615767.1.46284 WP_000615767.1.46290 WP_000615767.1.46295 WP_000615767.1.46309 WP_000615767.1.46470 WP_000615767.1.46483 WP_000615767.1.46495 WP_000615767.1.46500 WP_000615767.1.46501 WP_000615767.1.4656 WP_000615767.1.46560 WP_000615767.1.46562 WP_000615767.1.46565 WP_000615767.1.4659 WP_000615767.1.46598 WP_000615767.1.4663 WP_000615767.1.46634 WP_000615767.1.46649 WP_000615767.1.46656 WP_000615767.1.46665 WP_000615767.1.46683 WP_000615767.1.46687 WP_000615767.1.46694 WP_000615767.1.46709 WP_000615767.1.46716 WP_000615767.1.46721 WP_000615767.1.46784 WP_000615767.1.46789 WP_000615767.1.46809 WP_000615767.1.46831 WP_000615767.1.46858 WP_000615767.1.46871 WP_000615767.1.46884 WP_000615767.1.46892 WP_000615767.1.469 WP_000615767.1.46901 WP_000615767.1.46915 WP_000615767.1.46919 WP_000615767.1.46955 WP_000615767.1.46966 WP_000615767.1.47004 WP_000615767.1.47017 WP_000615767.1.47033 WP_000615767.1.47043 WP_000615767.1.47045 WP_000615767.1.47056 WP_000615767.1.4707 WP_000615767.1.47076 WP_000615767.1.47091 WP_000615767.1.47096 WP_000615767.1.47099 WP_000615767.1.47114 WP_000615767.1.47133 WP_000615767.1.47176 WP_000615767.1.47183 WP_000615767.1.47213 WP_000615767.1.47272 WP_000615767.1.47288 WP_000615767.1.47327 WP_000615767.1.47338 WP_000615767.1.47342 WP_000615767.1.47394 WP_000615767.1.47395 WP_000615767.1.47409 WP_000615767.1.47415 WP_000615767.1.47444 WP_000615767.1.47462 WP_000615767.1.47466 WP_000615767.1.47483 WP_000615767.1.47526 WP_000615767.1.47595 WP_000615767.1.47596 WP_000615767.1.47620 WP_000615767.1.47633 WP_000615767.1.47657 WP_000615767.1.4768 WP_000615767.1.47712 WP_000615767.1.47781 WP_000615767.1.47785 WP_000615767.1.478 WP_000615767.1.47806 WP_000615767.1.47819 WP_000615767.1.47824 WP_000615767.1.47853 WP_000615767.1.47860 WP_000615767.1.4789 WP_000615767.1.47890 WP_000615767.1.47905 WP_000615767.1.47948 WP_000615767.1.4798 WP_000615767.1.48031 WP_000615767.1.4804 WP_000615767.1.48043 WP_000615767.1.48060 WP_000615767.1.48089 WP_000615767.1.48103 WP_000615767.1.48118 WP_000615767.1.48148 WP_000615767.1.48181 WP_000615767.1.48213 WP_000615767.1.4822 WP_000615767.1.48224 WP_000615767.1.48257 WP_000615767.1.48296 WP_000615767.1.48395 WP_000615767.1.48420 WP_000615767.1.48447 WP_000615767.1.48468 WP_000615767.1.48481 WP_000615767.1.48489 WP_000615767.1.48503 WP_000615767.1.48520 WP_000615767.1.48589 WP_000615767.1.48594 WP_000615767.1.48595 WP_000615767.1.48625 WP_000615767.1.48627 WP_000615767.1.48669 WP_000615767.1.48710 WP_000615767.1.48713 WP_000615767.1.48718 WP_000615767.1.48730 WP_000615767.1.48753 WP_000615767.1.48758 WP_000615767.1.48762 WP_000615767.1.48780 WP_000615767.1.48796 WP_000615767.1.48799 WP_000615767.1.4882 WP_000615767.1.48828 WP_000615767.1.48867 WP_000615767.1.4894 WP_000615767.1.48944 WP_000615767.1.4895 WP_000615767.1.490 WP_000615767.1.49000 WP_000615767.1.49025 WP_000615767.1.49038 WP_000615767.1.49050 WP_000615767.1.49060 WP_000615767.1.49078 WP_000615767.1.49115 WP_000615767.1.49119 WP_000615767.1.49122 WP_000615767.1.49130 WP_000615767.1.49134 WP_000615767.1.49165 WP_000615767.1.49178 WP_000615767.1.49181 WP_000615767.1.492 WP_000615767.1.49213 WP_000615767.1.49232 WP_000615767.1.49268 WP_000615767.1.49283 WP_000615767.1.49324 WP_000615767.1.49331 WP_000615767.1.4936 WP_000615767.1.49385 WP_000615767.1.49389 WP_000615767.1.49407 WP_000615767.1.49510 WP_000615767.1.49511 WP_000615767.1.49540 WP_000615767.1.49543 WP_000615767.1.4957 WP_000615767.1.49571 WP_000615767.1.49587 WP_000615767.1.49635 WP_000615767.1.49656 WP_000615767.1.49692 WP_000615767.1.49759 WP_000615767.1.49776 WP_000615767.1.49785 WP_000615767.1.49873 WP_000615767.1.49889 WP_000615767.1.49901 WP_000615767.1.49909 WP_000615767.1.49915 WP_000615767.1.49955 WP_000615767.1.4996 WP_000615767.1.49973 WP_000615767.1.5000 WP_000615767.1.50005 WP_000615767.1.50031 WP_000615767.1.50048 WP_000615767.1.50059 WP_000615767.1.50089 WP_000615767.1.50094 WP_000615767.1.50108 WP_000615767.1.50129 WP_000615767.1.50134 WP_000615767.1.50139 WP_000615767.1.50151 WP_000615767.1.50184 WP_000615767.1.502 WP_000615767.1.5022 WP_000615767.1.50234 WP_000615767.1.50244 WP_000615767.1.50246 WP_000615767.1.50275 WP_000615767.1.50296 WP_000615767.1.50311 WP_000615767.1.50315 WP_000615767.1.50327 WP_000615767.1.50383 WP_000615767.1.50396 WP_000615767.1.50442 WP_000615767.1.50454 WP_000615767.1.50467 WP_000615767.1.50474 WP_000615767.1.50501 WP_000615767.1.50532 WP_000615767.1.50560 WP_000615767.1.50572 WP_000615767.1.50580 WP_000615767.1.50582 WP_000615767.1.50603 WP_000615767.1.50606 WP_000615767.1.50613 WP_000615767.1.50615 WP_000615767.1.50621 WP_000615767.1.50637 WP_000615767.1.5065 WP_000615767.1.50739 WP_000615767.1.50743 WP_000615767.1.50757 WP_000615767.1.50821 WP_000615767.1.50824 WP_000615767.1.50835 WP_000615767.1.50836 WP_000615767.1.50846 WP_000615767.1.50849 WP_000615767.1.50879 WP_000615767.1.50911 WP_000615767.1.50915 WP_000615767.1.50921 WP_000615767.1.50930 WP_000615767.1.50978 WP_000615767.1.50985 WP_000615767.1.51012 WP_000615767.1.51041 WP_000615767.1.51079 WP_000615767.1.51080 WP_000615767.1.51089 WP_000615767.1.51094 WP_000615767.1.51096 WP_000615767.1.51098 WP_000615767.1.5112 WP_000615767.1.51143 WP_000615767.1.51188 WP_000615767.1.51205 WP_000615767.1.51218 WP_000615767.1.5122 WP_000615767.1.51237 WP_000615767.1.51238 WP_000615767.1.51241 WP_000615767.1.51243 WP_000615767.1.51249 WP_000615767.1.51316 WP_000615767.1.51367 WP_000615767.1.51379 WP_000615767.1.51383 WP_000615767.1.51417 WP_000615767.1.51420 WP_000615767.1.51439 WP_000615767.1.51470 WP_000615767.1.51507 WP_000615767.1.51546 WP_000615767.1.51579 WP_000615767.1.51626 WP_000615767.1.51635 WP_000615767.1.51673 WP_000615767.1.51684 WP_000615767.1.5169 WP_000615767.1.51715 WP_000615767.1.51726 WP_000615767.1.51750 WP_000615767.1.51762 WP_000615767.1.51774 WP_000615767.1.51806 WP_000615767.1.51825 WP_000615767.1.51826 WP_000615767.1.51830 WP_000615767.1.51855 WP_000615767.1.51893 WP_000615767.1.51962 WP_000615767.1.52004 WP_000615767.1.52007 WP_000615767.1.52026 WP_000615767.1.5204 WP_000615767.1.52042 WP_000615767.1.52055 WP_000615767.1.52060 WP_000615767.1.52064 WP_000615767.1.52108 WP_000615767.1.52116 WP_000615767.1.5212 WP_000615767.1.52245 WP_000615767.1.52292 WP_000615767.1.52315 WP_000615767.1.52317 WP_000615767.1.52319 WP_000615767.1.52329 WP_000615767.1.52384 WP_000615767.1.5242 WP_000615767.1.52443 WP_000615767.1.52453 WP_000615767.1.52515 WP_000615767.1.52551 WP_000615767.1.5256 WP_000615767.1.52570 WP_000615767.1.52666 WP_000615767.1.52681 WP_000615767.1.52709 WP_000615767.1.52721 WP_000615767.1.52786 WP_000615767.1.52788 WP_000615767.1.52834 WP_000615767.1.52843 WP_000615767.1.52856 WP_000615767.1.52862 WP_000615767.1.52921 WP_000615767.1.52923 WP_000615767.1.52940 WP_000615767.1.52953 WP_000615767.1.52957 WP_000615767.1.52978 WP_000615767.1.5298 WP_000615767.1.52987 WP_000615767.1.52988 WP_000615767.1.53004 WP_000615767.1.53039 WP_000615767.1.53040 WP_000615767.1.53042 WP_000615767.1.53054 WP_000615767.1.53079 WP_000615767.1.53096 WP_000615767.1.53108 WP_000615767.1.53112 WP_000615767.1.53135 WP_000615767.1.53166 WP_000615767.1.53183 WP_000615767.1.53188 WP_000615767.1.53205 WP_000615767.1.53212 WP_000615767.1.53241 WP_000615767.1.53243 WP_000615767.1.53249 WP_000615767.1.53291 WP_000615767.1.53320 WP_000615767.1.53337 WP_000615767.1.53355 WP_000615767.1.53357 WP_000615767.1.53365 WP_000615767.1.53380 WP_000615767.1.53384 WP_000615767.1.53395 WP_000615767.1.53405 WP_000615767.1.53420 WP_000615767.1.53429 WP_000615767.1.53430 WP_000615767.1.53440 WP_000615767.1.53476 WP_000615767.1.5348 WP_000615767.1.53524 WP_000615767.1.53547 WP_000615767.1.53581 WP_000615767.1.5361 WP_000615767.1.53611 WP_000615767.1.5364 WP_000615767.1.53652 WP_000615767.1.53673 WP_000615767.1.53697 WP_000615767.1.53699 WP_000615767.1.53756 WP_000615767.1.5377 WP_000615767.1.53785 WP_000615767.1.53789 WP_000615767.1.5385 WP_000615767.1.53871 WP_000615767.1.53950 WP_000615767.1.53957 WP_000615767.1.5396 WP_000615767.1.54009 WP_000615767.1.54020 WP_000615767.1.54041 WP_000615767.1.5405 WP_000615767.1.54050 WP_000615767.1.54065 WP_000615767.1.54066 WP_000615767.1.54069 WP_000615767.1.54110 WP_000615767.1.54157 WP_000615767.1.54163 WP_000615767.1.5418 WP_000615767.1.54235 WP_000615767.1.5424 WP_000615767.1.54257 WP_000615767.1.54288 WP_000615767.1.543 WP_000615767.1.54334 WP_000615767.1.54345 WP_000615767.1.5435 WP_000615767.1.54374 WP_000615767.1.54376 WP_000615767.1.54401 WP_000615767.1.54402 WP_000615767.1.5442 WP_000615767.1.54424 WP_000615767.1.54433 WP_000615767.1.54529 WP_000615767.1.5453 WP_000615767.1.54549 WP_000615767.1.54559 WP_000615767.1.54576 WP_000615767.1.54582 WP_000615767.1.54597 WP_000615767.1.54610 WP_000615767.1.54658 WP_000615767.1.54738 WP_000615767.1.54762 WP_000615767.1.54796 WP_000615767.1.54805 WP_000615767.1.54840 WP_000615767.1.54848 WP_000615767.1.54862 WP_000615767.1.54894 WP_000615767.1.54907 WP_000615767.1.54922 WP_000615767.1.54924 WP_000615767.1.54932 WP_000615767.1.54938 WP_000615767.1.5495 WP_000615767.1.54960 WP_000615767.1.550 WP_000615767.1.55035 WP_000615767.1.55039 WP_000615767.1.55053 WP_000615767.1.55078 WP_000615767.1.55091 WP_000615767.1.55120 WP_000615767.1.55148 WP_000615767.1.55154 WP_000615767.1.55207 WP_000615767.1.55217 WP_000615767.1.55281 WP_000615767.1.55292 WP_000615767.1.55298 WP_000615767.1.55299 WP_000615767.1.55312 WP_000615767.1.55314 WP_000615767.1.55329 WP_000615767.1.55337 WP_000615767.1.55360 WP_000615767.1.55388 WP_000615767.1.55395 WP_000615767.1.55404 WP_000615767.1.55411 WP_000615767.1.55426 WP_000615767.1.55438 WP_000615767.1.55499 WP_000615767.1.55523 WP_000615767.1.55525 WP_000615767.1.55531 WP_000615767.1.55534 WP_000615767.1.55716 WP_000615767.1.55722 WP_000615767.1.55733 WP_000615767.1.55736 WP_000615767.1.55756 WP_000615767.1.55761 WP_000615767.1.55763 WP_000615767.1.55816 WP_000615767.1.5586 WP_000615767.1.55947 WP_000615767.1.55969 WP_000615767.1.55978 WP_000615767.1.55980 WP_000615767.1.5599 WP_000615767.1.560 WP_000615767.1.56023 WP_000615767.1.56041 WP_000615767.1.56112 WP_000615767.1.56136 WP_000615767.1.5615 WP_000615767.1.56185 WP_000615767.1.56257 WP_000615767.1.56266 WP_000615767.1.56276 WP_000615767.1.56283 WP_000615767.1.56288 WP_000615767.1.56294 WP_000615767.1.56300 WP_000615767.1.56316 WP_000615767.1.56378 WP_000615767.1.56427 WP_000615767.1.56462 WP_000615767.1.56472 WP_000615767.1.56477 WP_000615767.1.56505 WP_000615767.1.56515 WP_000615767.1.56518 WP_000615767.1.56519 WP_000615767.1.5652 WP_000615767.1.56546 WP_000615767.1.56582 WP_000615767.1.56607 WP_000615767.1.56610 WP_000615767.1.56617 WP_000615767.1.5663 WP_000615767.1.56676 WP_000615767.1.56734 WP_000615767.1.56739 WP_000615767.1.56746 WP_000615767.1.56756 WP_000615767.1.56765 WP_000615767.1.56774 WP_000615767.1.56805 WP_000615767.1.56881 WP_000615767.1.56884 WP_000615767.1.5689 WP_000615767.1.56940 WP_000615767.1.56989 WP_000615767.1.57001 WP_000615767.1.57004 WP_000615767.1.57009 WP_000615767.1.57017 WP_000615767.1.57037 WP_000615767.1.57040 WP_000615767.1.5708 WP_000615767.1.57089 WP_000615767.1.5709 WP_000615767.1.57103 WP_000615767.1.57118 WP_000615767.1.57119 WP_000615767.1.57127 WP_000615767.1.57176 WP_000615767.1.57192 WP_000615767.1.57219 WP_000615767.1.57235 WP_000615767.1.57252 WP_000615767.1.57274 WP_000615767.1.57279 WP_000615767.1.57366 WP_000615767.1.57394 WP_000615767.1.57442 WP_000615767.1.57490 WP_000615767.1.57503 WP_000615767.1.57516 WP_000615767.1.57530 WP_000615767.1.5757 WP_000615767.1.57591 WP_000615767.1.57611 WP_000615767.1.57615 WP_000615767.1.57687 WP_000615767.1.57691 WP_000615767.1.57698 WP_000615767.1.57712 WP_000615767.1.57725 WP_000615767.1.57726 WP_000615767.1.57743 WP_000615767.1.57750 WP_000615767.1.57753 WP_000615767.1.57760 WP_000615767.1.57777 WP_000615767.1.5779 WP_000615767.1.578 WP_000615767.1.57816 WP_000615767.1.57822 WP_000615767.1.57866 WP_000615767.1.57867 WP_000615767.1.57876 WP_000615767.1.57882 WP_000615767.1.57896 WP_000615767.1.57897 WP_000615767.1.57922 WP_000615767.1.5793 WP_000615767.1.57977 WP_000615767.1.58020 WP_000615767.1.58021 WP_000615767.1.5803 WP_000615767.1.58034 WP_000615767.1.58036 WP_000615767.1.58076 WP_000615767.1.5808 WP_000615767.1.58124 WP_000615767.1.5813 WP_000615767.1.58135 WP_000615767.1.58156 WP_000615767.1.58166 WP_000615767.1.58181 WP_000615767.1.5819 WP_000615767.1.58196 WP_000615767.1.58217 WP_000615767.1.58227 WP_000615767.1.58243 WP_000615767.1.58268 WP_000615767.1.58331 WP_000615767.1.58333 WP_000615767.1.58341 WP_000615767.1.58348 WP_000615767.1.58376 WP_000615767.1.58378 WP_000615767.1.58402 WP_000615767.1.58404 WP_000615767.1.58434 WP_000615767.1.58452 WP_000615767.1.58480 WP_000615767.1.58522 WP_000615767.1.58553 WP_000615767.1.58554 WP_000615767.1.58595 WP_000615767.1.58607 WP_000615767.1.58613 WP_000615767.1.58615 WP_000615767.1.58627 WP_000615767.1.58642 WP_000615767.1.58646 WP_000615767.1.58684 WP_000615767.1.58700 WP_000615767.1.58717 WP_000615767.1.58738 WP_000615767.1.58854 WP_000615767.1.5887 WP_000615767.1.58905 WP_000615767.1.5892 WP_000615767.1.59001 WP_000615767.1.59018 WP_000615767.1.59065 WP_000615767.1.59066 WP_000615767.1.59081 WP_000615767.1.59109 WP_000615767.1.59117 WP_000615767.1.59137 WP_000615767.1.59141 WP_000615767.1.59198 WP_000615767.1.59208 WP_000615767.1.59215 WP_000615767.1.59229 WP_000615767.1.59235 WP_000615767.1.59242 WP_000615767.1.59268 WP_000615767.1.59289 WP_000615767.1.5934 WP_000615767.1.59361 WP_000615767.1.59367 WP_000615767.1.5939 WP_000615767.1.59424 WP_000615767.1.59442 WP_000615767.1.59482 WP_000615767.1.59497 WP_000615767.1.59534 WP_000615767.1.59552 WP_000615767.1.59606 WP_000615767.1.59607 WP_000615767.1.59608 WP_000615767.1.5964 WP_000615767.1.59642 WP_000615767.1.59666 WP_000615767.1.59670 WP_000615767.1.59673 WP_000615767.1.59676 WP_000615767.1.59678 WP_000615767.1.59700 WP_000615767.1.59718 WP_000615767.1.59721 WP_000615767.1.59740 WP_000615767.1.59766 WP_000615767.1.59859 WP_000615767.1.59867 WP_000615767.1.59883 WP_000615767.1.59884 WP_000615767.1.59895 WP_000615767.1.59903 WP_000615767.1.59906 WP_000615767.1.59913 WP_000615767.1.59918 WP_000615767.1.59935 WP_000615767.1.59938 WP_000615767.1.59951 WP_000615767.1.60014 WP_000615767.1.60026 WP_000615767.1.60064 WP_000615767.1.60073 WP_000615767.1.60083 WP_000615767.1.60105 WP_000615767.1.60148 WP_000615767.1.60177 WP_000615767.1.60188 WP_000615767.1.60210 WP_000615767.1.60242 WP_000615767.1.60248 WP_000615767.1.60256 WP_000615767.1.60281 WP_000615767.1.60303 WP_000615767.1.60309 WP_000615767.1.60326 WP_000615767.1.60384 WP_000615767.1.60420 WP_000615767.1.60438 WP_000615767.1.60450 WP_000615767.1.6046 WP_000615767.1.60485 WP_000615767.1.60521 WP_000615767.1.60529 WP_000615767.1.60541 WP_000615767.1.60596 WP_000615767.1.60601 WP_000615767.1.60615 WP_000615767.1.60621 WP_000615767.1.6063 WP_000615767.1.60637 WP_000615767.1.60642 WP_000615767.1.60645 WP_000615767.1.60646 WP_000615767.1.60656 WP_000615767.1.60693 WP_000615767.1.60714 WP_000615767.1.60723 WP_000615767.1.60731 WP_000615767.1.60737 WP_000615767.1.60749 WP_000615767.1.60755 WP_000615767.1.60756 WP_000615767.1.6079 WP_000615767.1.6081 WP_000615767.1.60867 WP_000615767.1.6087 WP_000615767.1.6088 WP_000615767.1.60886 WP_000615767.1.60911 WP_000615767.1.60924 WP_000615767.1.60961 WP_000615767.1.60985 WP_000615767.1.60996 WP_000615767.1.61028 WP_000615767.1.61050 WP_000615767.1.61159 WP_000615767.1.61160 WP_000615767.1.61164 WP_000615767.1.61194 WP_000615767.1.61208 WP_000615767.1.61217 WP_000615767.1.61236 WP_000615767.1.61254 WP_000615767.1.61301 WP_000615767.1.61363 WP_000615767.1.61372 WP_000615767.1.6140 WP_000615767.1.61404 WP_000615767.1.61405 WP_000615767.1.61444 WP_000615767.1.61451 WP_000615767.1.61460 WP_000615767.1.61471 WP_000615767.1.61489 WP_000615767.1.61499 WP_000615767.1.61513 WP_000615767.1.61514 WP_000615767.1.61546 WP_000615767.1.61548 WP_000615767.1.61550 WP_000615767.1.61560 WP_000615767.1.61568 WP_000615767.1.61611 WP_000615767.1.61627 WP_000615767.1.61686 WP_000615767.1.61700 WP_000615767.1.61731 WP_000615767.1.61733 WP_000615767.1.6174 WP_000615767.1.61765 WP_000615767.1.6177 WP_000615767.1.61801 WP_000615767.1.61807 WP_000615767.1.6183 WP_000615767.1.61839 WP_000615767.1.61845 WP_000615767.1.61912 WP_000615767.1.61916 WP_000615767.1.6192 WP_000615767.1.61934 WP_000615767.1.61954 WP_000615767.1.61964 WP_000615767.1.62001 WP_000615767.1.62022 WP_000615767.1.62039 WP_000615767.1.6207 WP_000615767.1.62118 WP_000615767.1.62129 WP_000615767.1.62174 WP_000615767.1.62178 WP_000615767.1.62190 WP_000615767.1.62235 WP_000615767.1.62283 WP_000615767.1.62316 WP_000615767.1.6235 WP_000615767.1.62366 WP_000615767.1.62390 WP_000615767.1.62391 WP_000615767.1.62394 WP_000615767.1.62397 WP_000615767.1.62417 WP_000615767.1.62420 WP_000615767.1.62421 WP_000615767.1.62465 WP_000615767.1.62518 WP_000615767.1.62521 WP_000615767.1.62524 WP_000615767.1.62528 WP_000615767.1.62540 WP_000615767.1.62546 WP_000615767.1.62558 WP_000615767.1.62566 WP_000615767.1.6258 WP_000615767.1.62583 WP_000615767.1.62585 WP_000615767.1.62600 WP_000615767.1.62607 WP_000615767.1.62638 WP_000615767.1.62667 WP_000615767.1.62670 WP_000615767.1.62775 WP_000615767.1.62777 WP_000615767.1.62793 WP_000615767.1.62799 WP_000615767.1.62803 WP_000615767.1.62821 WP_000615767.1.62836 WP_000615767.1.62862 WP_000615767.1.62867 WP_000615767.1.62900 WP_000615767.1.62969 WP_000615767.1.62994 WP_000615767.1.63029 WP_000615767.1.63033 WP_000615767.1.63055 WP_000615767.1.63067 WP_000615767.1.63075 WP_000615767.1.63077 WP_000615767.1.6309 WP_000615767.1.63149 WP_000615767.1.63156 WP_000615767.1.6316 WP_000615767.1.63165 WP_000615767.1.63245 WP_000615767.1.63375 WP_000615767.1.6341 WP_000615767.1.63425 WP_000615767.1.63430 WP_000615767.1.63431 WP_000615767.1.63468 WP_000615767.1.63473 WP_000615767.1.63506 WP_000615767.1.63544 WP_000615767.1.63621 WP_000615767.1.63675 WP_000615767.1.63691 WP_000615767.1.63741 WP_000615767.1.63753 WP_000615767.1.63756 WP_000615767.1.63762 WP_000615767.1.63787 WP_000615767.1.63788 WP_000615767.1.63846 WP_000615767.1.63893 WP_000615767.1.63908 WP_000615767.1.63927 WP_000615767.1.63931 WP_000615767.1.63938 WP_000615767.1.63943 WP_000615767.1.63988 WP_000615767.1.64002 WP_000615767.1.64006 WP_000615767.1.64042 WP_000615767.1.64055 WP_000615767.1.64067 WP_000615767.1.64090 WP_000615767.1.64126 WP_000615767.1.64132 WP_000615767.1.6414 WP_000615767.1.64163 WP_000615767.1.64167 WP_000615767.1.64172 WP_000615767.1.64184 WP_000615767.1.64224 WP_000615767.1.64225 WP_000615767.1.64246 WP_000615767.1.64262 WP_000615767.1.64269 WP_000615767.1.64313 WP_000615767.1.64316 WP_000615767.1.64338 WP_000615767.1.64342 WP_000615767.1.64416 WP_000615767.1.64449 WP_000615767.1.64464 WP_000615767.1.64518 WP_000615767.1.64572 WP_000615767.1.6467 WP_000615767.1.64679 WP_000615767.1.64698 WP_000615767.1.6470 WP_000615767.1.64700 WP_000615767.1.64719 WP_000615767.1.64723 WP_000615767.1.64725 WP_000615767.1.64728 WP_000615767.1.64733 WP_000615767.1.64734 WP_000615767.1.64739 WP_000615767.1.6474 WP_000615767.1.64816 WP_000615767.1.64824 WP_000615767.1.64851 WP_000615767.1.64857 WP_000615767.1.64876 WP_000615767.1.6491 WP_000615767.1.64913 WP_000615767.1.64917 WP_000615767.1.64925 WP_000615767.1.64960 WP_000615767.1.6498 WP_000615767.1.65031 WP_000615767.1.6504 WP_000615767.1.6505 WP_000615767.1.65062 WP_000615767.1.65063 WP_000615767.1.65107 WP_000615767.1.65119 WP_000615767.1.6515 WP_000615767.1.65232 WP_000615767.1.65235 WP_000615767.1.65265 WP_000615767.1.65307 WP_000615767.1.65318 WP_000615767.1.65331 WP_000615767.1.65336 WP_000615767.1.65352 WP_000615767.1.65368 WP_000615767.1.65371 WP_000615767.1.65396 WP_000615767.1.65418 WP_000615767.1.65442 WP_000615767.1.65452 WP_000615767.1.65476 WP_000615767.1.65485 WP_000615767.1.65492 WP_000615767.1.65536 WP_000615767.1.65568 WP_000615767.1.65574 WP_000615767.1.65577 WP_000615767.1.65587 WP_000615767.1.65607 WP_000615767.1.65641 WP_000615767.1.65690 WP_000615767.1.65722 WP_000615767.1.65742 WP_000615767.1.65748 WP_000615767.1.65773 WP_000615767.1.65789 WP_000615767.1.65792 WP_000615767.1.658 WP_000615767.1.65806 WP_000615767.1.65814 WP_000615767.1.65837 WP_000615767.1.65853 WP_000615767.1.65916 WP_000615767.1.65936 WP_000615767.1.65941 WP_000615767.1.6598 WP_000615767.1.66003 WP_000615767.1.66006 WP_000615767.1.66024 WP_000615767.1.66046 WP_000615767.1.66087 WP_000615767.1.66132 WP_000615767.1.66146 WP_000615767.1.66164 WP_000615767.1.66166 WP_000615767.1.66170 WP_000615767.1.66205 WP_000615767.1.66207 WP_000615767.1.6621 WP_000615767.1.66230 WP_000615767.1.6625 WP_000615767.1.66274 WP_000615767.1.66278 WP_000615767.1.663 WP_000615767.1.66307 WP_000615767.1.66309 WP_000615767.1.66333 WP_000615767.1.66356 WP_000615767.1.66381 WP_000615767.1.66399 WP_000615767.1.66411 WP_000615767.1.66477 WP_000615767.1.66500 WP_000615767.1.66517 WP_000615767.1.66536 WP_000615767.1.66569 WP_000615767.1.66571 WP_000615767.1.66586 WP_000615767.1.66595 WP_000615767.1.66620 WP_000615767.1.66640 WP_000615767.1.66653 WP_000615767.1.66654 WP_000615767.1.66674 WP_000615767.1.66687 WP_000615767.1.66694 WP_000615767.1.66734 WP_000615767.1.66757 WP_000615767.1.66781 WP_000615767.1.6679 WP_000615767.1.66797 WP_000615767.1.66813 WP_000615767.1.66835 WP_000615767.1.66852 WP_000615767.1.66881 WP_000615767.1.66894 WP_000615767.1.669 WP_000615767.1.66917 WP_000615767.1.6694 WP_000615767.1.6695 WP_000615767.1.66964 WP_000615767.1.66966 WP_000615767.1.66983 WP_000615767.1.66995 WP_000615767.1.67051 WP_000615767.1.67114 WP_000615767.1.67121 WP_000615767.1.67169 WP_000615767.1.67196 WP_000615767.1.67206 WP_000615767.1.67215 WP_000615767.1.67274 WP_000615767.1.67304 WP_000615767.1.67327 WP_000615767.1.67349 WP_000615767.1.67353 WP_000615767.1.67358 WP_000615767.1.67389 WP_000615767.1.67398 WP_000615767.1.67401 WP_000615767.1.67416 WP_000615767.1.67432 WP_000615767.1.67469 WP_000615767.1.67494 WP_000615767.1.67498 WP_000615767.1.67510 WP_000615767.1.67565 WP_000615767.1.67583 WP_000615767.1.67594 WP_000615767.1.67596 WP_000615767.1.67648 WP_000615767.1.67655 WP_000615767.1.6773 WP_000615767.1.67739 WP_000615767.1.67741 WP_000615767.1.67748 WP_000615767.1.6776 WP_000615767.1.67793 WP_000615767.1.67797 WP_000615767.1.67804 WP_000615767.1.67807 WP_000615767.1.67831 WP_000615767.1.67840 WP_000615767.1.67921 WP_000615767.1.67930 WP_000615767.1.67965 WP_000615767.1.67979 WP_000615767.1.68002 WP_000615767.1.68017 WP_000615767.1.68048 WP_000615767.1.68061 WP_000615767.1.68077 WP_000615767.1.68078 WP_000615767.1.681 WP_000615767.1.68103 WP_000615767.1.6812 WP_000615767.1.68181 WP_000615767.1.68192 WP_000615767.1.68220 WP_000615767.1.68238 WP_000615767.1.68267 WP_000615767.1.68287 WP_000615767.1.68323 WP_000615767.1.68352 WP_000615767.1.68393 WP_000615767.1.68427 WP_000615767.1.68430 WP_000615767.1.68431 WP_000615767.1.68460 WP_000615767.1.68464 WP_000615767.1.68503 WP_000615767.1.68531 WP_000615767.1.68535 WP_000615767.1.68544 WP_000615767.1.68567 WP_000615767.1.68595 WP_000615767.1.68600 WP_000615767.1.68605 WP_000615767.1.68622 WP_000615767.1.68653 WP_000615767.1.68661 WP_000615767.1.68671 WP_000615767.1.68682 WP_000615767.1.68686 WP_000615767.1.68689 WP_000615767.1.68784 WP_000615767.1.68807 WP_000615767.1.68819 WP_000615767.1.68820 WP_000615767.1.68822 WP_000615767.1.68825 WP_000615767.1.68835 WP_000615767.1.68852 WP_000615767.1.68872 WP_000615767.1.6890 WP_000615767.1.68939 WP_000615767.1.68960 WP_000615767.1.68963 WP_000615767.1.68992 WP_000615767.1.690 WP_000615767.1.69000 WP_000615767.1.69005 WP_000615767.1.69037 WP_000615767.1.69052 WP_000615767.1.69057 WP_000615767.1.69063 WP_000615767.1.69065 WP_000615767.1.69097 WP_000615767.1.69104 WP_000615767.1.69116 WP_000615767.1.69137 WP_000615767.1.69148 WP_000615767.1.69149 WP_000615767.1.69224 WP_000615767.1.69230 WP_000615767.1.69241 WP_000615767.1.69246 WP_000615767.1.69285 WP_000615767.1.69321 WP_000615767.1.69344 WP_000615767.1.69399 WP_000615767.1.69407 WP_000615767.1.69416 WP_000615767.1.69428 WP_000615767.1.69431 WP_000615767.1.6948 WP_000615767.1.69486 WP_000615767.1.69493 WP_000615767.1.69499 WP_000615767.1.69500 WP_000615767.1.69512 WP_000615767.1.69541 WP_000615767.1.69543 WP_000615767.1.69549 WP_000615767.1.69591 WP_000615767.1.6961 WP_000615767.1.69653 WP_000615767.1.69671 WP_000615767.1.6969 WP_000615767.1.69695 WP_000615767.1.6970 WP_000615767.1.69731 WP_000615767.1.69739 WP_000615767.1.69757 WP_000615767.1.69797 WP_000615767.1.69850 WP_000615767.1.69863 WP_000615767.1.69866 WP_000615767.1.6988 WP_000615767.1.69905 WP_000615767.1.69940 WP_000615767.1.69946 WP_000615767.1.69954 WP_000615767.1.69962 WP_000615767.1.7 WP_000615767.1.70011 WP_000615767.1.70020 WP_000615767.1.70051 WP_000615767.1.70056 WP_000615767.1.70060 WP_000615767.1.70064 WP_000615767.1.70073 WP_000615767.1.70075 WP_000615767.1.70110 WP_000615767.1.70119 WP_000615767.1.70121 WP_000615767.1.70142 WP_000615767.1.70150 WP_000615767.1.70159 WP_000615767.1.70166 WP_000615767.1.7018 WP_000615767.1.70199 WP_000615767.1.70214 WP_000615767.1.70221 WP_000615767.1.70223 WP_000615767.1.70224 WP_000615767.1.70267 WP_000615767.1.70302 WP_000615767.1.70307 WP_000615767.1.70308 WP_000615767.1.70315 WP_000615767.1.70316 WP_000615767.1.70329 WP_000615767.1.70336 WP_000615767.1.70360 WP_000615767.1.70400 WP_000615767.1.70409 WP_000615767.1.70421 WP_000615767.1.70453 WP_000615767.1.7047 WP_000615767.1.70508 WP_000615767.1.70513 WP_000615767.1.70520 WP_000615767.1.70524 WP_000615767.1.70528 WP_000615767.1.70535 WP_000615767.1.70557 WP_000615767.1.70567 WP_000615767.1.70574 WP_000615767.1.70617 WP_000615767.1.70620 WP_000615767.1.70674 WP_000615767.1.70707 WP_000615767.1.70741 WP_000615767.1.7075 WP_000615767.1.7076 WP_000615767.1.70766 WP_000615767.1.70802 WP_000615767.1.7081 WP_000615767.1.70828 WP_000615767.1.70838 WP_000615767.1.70867 WP_000615767.1.70876 WP_000615767.1.70877 WP_000615767.1.70887 WP_000615767.1.70916 WP_000615767.1.70931 WP_000615767.1.70949 WP_000615767.1.70951 WP_000615767.1.70961 WP_000615767.1.71020 WP_000615767.1.71053 WP_000615767.1.71060 WP_000615767.1.71078 WP_000615767.1.7112 WP_000615767.1.71133 WP_000615767.1.71177 WP_000615767.1.71206 WP_000615767.1.71211 WP_000615767.1.7123 WP_000615767.1.7126 WP_000615767.1.71270 WP_000615767.1.71277 WP_000615767.1.71369 WP_000615767.1.71415 WP_000615767.1.71436 WP_000615767.1.71460 WP_000615767.1.71534 WP_000615767.1.71598 WP_000615767.1.71599 WP_000615767.1.71663 WP_000615767.1.71673 WP_000615767.1.71675 WP_000615767.1.71758 WP_000615767.1.71773 WP_000615767.1.71782 WP_000615767.1.71787 WP_000615767.1.71808 WP_000615767.1.71818 WP_000615767.1.71824 WP_000615767.1.71841 WP_000615767.1.71870 WP_000615767.1.71879 WP_000615767.1.71883 WP_000615767.1.71977 WP_000615767.1.72009 WP_000615767.1.72043 WP_000615767.1.72095 WP_000615767.1.72096 WP_000615767.1.721 WP_000615767.1.72108 WP_000615767.1.72115 WP_000615767.1.7214 WP_000615767.1.72145 WP_000615767.1.72163 WP_000615767.1.72233 WP_000615767.1.72251 WP_000615767.1.72253 WP_000615767.1.72309 WP_000615767.1.72321 WP_000615767.1.72368 WP_000615767.1.72390 WP_000615767.1.72407 WP_000615767.1.72416 WP_000615767.1.72426 WP_000615767.1.72502 WP_000615767.1.72534 WP_000615767.1.72561 WP_000615767.1.72565 WP_000615767.1.72630 WP_000615767.1.7268 WP_000615767.1.727 WP_000615767.1.72705 WP_000615767.1.7271 WP_000615767.1.72712 WP_000615767.1.72769 WP_000615767.1.72781 WP_000615767.1.7279 WP_000615767.1.72911 WP_000615767.1.72922 WP_000615767.1.72926 WP_000615767.1.72932 WP_000615767.1.72934 WP_000615767.1.72940 WP_000615767.1.72942 WP_000615767.1.72978 WP_000615767.1.7300 WP_000615767.1.73012 WP_000615767.1.73064 WP_000615767.1.73065 WP_000615767.1.73071 WP_000615767.1.73089 WP_000615767.1.73093 WP_000615767.1.73099 WP_000615767.1.73100 WP_000615767.1.73101 WP_000615767.1.73106 WP_000615767.1.73133 WP_000615767.1.73181 WP_000615767.1.732 WP_000615767.1.73227 WP_000615767.1.73288 WP_000615767.1.73320 WP_000615767.1.73322 WP_000615767.1.73324 WP_000615767.1.73336 WP_000615767.1.73356 WP_000615767.1.73357 WP_000615767.1.73359 WP_000615767.1.73397 WP_000615767.1.73438 WP_000615767.1.73462 WP_000615767.1.73476 WP_000615767.1.73502 WP_000615767.1.73522 WP_000615767.1.73525 WP_000615767.1.73543 WP_000615767.1.73548 WP_000615767.1.73578 WP_000615767.1.73588 WP_000615767.1.7359 WP_000615767.1.73593 WP_000615767.1.73666 WP_000615767.1.73675 WP_000615767.1.73725 WP_000615767.1.73747 WP_000615767.1.73777 WP_000615767.1.73800 WP_000615767.1.73825 WP_000615767.1.73838 WP_000615767.1.73851 WP_000615767.1.73907 WP_000615767.1.73912 WP_000615767.1.73913 WP_000615767.1.73914 WP_000615767.1.73979 WP_000615767.1.73982 WP_000615767.1.74015 WP_000615767.1.74069 WP_000615767.1.74075 WP_000615767.1.74084 WP_000615767.1.7409 WP_000615767.1.74105 WP_000615767.1.74127 WP_000615767.1.7416 WP_000615767.1.7420 WP_000615767.1.74206 WP_000615767.1.74208 WP_000615767.1.74220 WP_000615767.1.74233 WP_000615767.1.74239 WP_000615767.1.74250 WP_000615767.1.74308 WP_000615767.1.7431 WP_000615767.1.74314 WP_000615767.1.74331 WP_000615767.1.74341 WP_000615767.1.74363 WP_000615767.1.74364 WP_000615767.1.74385 WP_000615767.1.74387 WP_000615767.1.74396 WP_000615767.1.74419 WP_000615767.1.74443 WP_000615767.1.74448 WP_000615767.1.7449 WP_000615767.1.74516 WP_000615767.1.74537 WP_000615767.1.74550 WP_000615767.1.74679 WP_000615767.1.7468 WP_000615767.1.74751 WP_000615767.1.74762 WP_000615767.1.74780 WP_000615767.1.74796 WP_000615767.1.74822 WP_000615767.1.74848 WP_000615767.1.74891 WP_000615767.1.74940 WP_000615767.1.7497 WP_000615767.1.74974 WP_000615767.1.7503 WP_000615767.1.75049 WP_000615767.1.75053 WP_000615767.1.75085 WP_000615767.1.75088 WP_000615767.1.75094 WP_000615767.1.75099 WP_000615767.1.75123 WP_000615767.1.75130 WP_000615767.1.75142 WP_000615767.1.75165 WP_000615767.1.7517 WP_000615767.1.75203 WP_000615767.1.75222 WP_000615767.1.75259 WP_000615767.1.7527 WP_000615767.1.75284 WP_000615767.1.75312 WP_000615767.1.75317 WP_000615767.1.75325 WP_000615767.1.75335 WP_000615767.1.75336 WP_000615767.1.75370 WP_000615767.1.75384 WP_000615767.1.75406 WP_000615767.1.75429 WP_000615767.1.75455 WP_000615767.1.75464 WP_000615767.1.75490 WP_000615767.1.75492 WP_000615767.1.75547 WP_000615767.1.75582 WP_000615767.1.75586 WP_000615767.1.75654 WP_000615767.1.75675 WP_000615767.1.75691 WP_000615767.1.75701 WP_000615767.1.75729 WP_000615767.1.75755 WP_000615767.1.75759 WP_000615767.1.75787 WP_000615767.1.75834 WP_000615767.1.75857 WP_000615767.1.75876 WP_000615767.1.75897 WP_000615767.1.75904 WP_000615767.1.75907 WP_000615767.1.75976 WP_000615767.1.75987 WP_000615767.1.75996 WP_000615767.1.760 WP_000615767.1.76017 WP_000615767.1.76018 WP_000615767.1.76056 WP_000615767.1.76068 WP_000615767.1.76080 WP_000615767.1.76093 WP_000615767.1.76154 WP_000615767.1.76161 WP_000615767.1.76165 WP_000615767.1.76202 WP_000615767.1.76220 WP_000615767.1.76233 WP_000615767.1.76249 WP_000615767.1.76251 WP_000615767.1.76263 WP_000615767.1.76265 WP_000615767.1.76285 WP_000615767.1.76303 WP_000615767.1.76344 WP_000615767.1.76375 WP_000615767.1.76377 WP_000615767.1.76393 WP_000615767.1.76409 WP_000615767.1.76439 WP_000615767.1.76453 WP_000615767.1.76454 WP_000615767.1.76458 WP_000615767.1.76492 WP_000615767.1.76517 WP_000615767.1.76564 WP_000615767.1.76567 WP_000615767.1.76614 WP_000615767.1.76649 WP_000615767.1.76650 WP_000615767.1.76667 WP_000615767.1.76675 WP_000615767.1.76692 WP_000615767.1.7673 WP_000615767.1.76764 WP_000615767.1.76777 WP_000615767.1.7678 WP_000615767.1.7679 WP_000615767.1.76826 WP_000615767.1.76830 WP_000615767.1.76837 WP_000615767.1.76850 WP_000615767.1.76874 WP_000615767.1.76892 WP_000615767.1.76927 WP_000615767.1.76942 WP_000615767.1.77 WP_000615767.1.77037 WP_000615767.1.77044 WP_000615767.1.77052 WP_000615767.1.7706 WP_000615767.1.77088 WP_000615767.1.77103 WP_000615767.1.77121 WP_000615767.1.7713 WP_000615767.1.77130 WP_000615767.1.7714 WP_000615767.1.77156 WP_000615767.1.77167 WP_000615767.1.77243 WP_000615767.1.77269 WP_000615767.1.77278 WP_000615767.1.77309 WP_000615767.1.77310 WP_000615767.1.77318 WP_000615767.1.7735 WP_000615767.1.77353 WP_000615767.1.77375 WP_000615767.1.77378 WP_000615767.1.77379 WP_000615767.1.77410 WP_000615767.1.77439 WP_000615767.1.77456 WP_000615767.1.77468 WP_000615767.1.77480 WP_000615767.1.77483 WP_000615767.1.77505 WP_000615767.1.77534 WP_000615767.1.77568 WP_000615767.1.77582 WP_000615767.1.77585 WP_000615767.1.77610 WP_000615767.1.77659 WP_000615767.1.77664 WP_000615767.1.77701 WP_000615767.1.77770 WP_000615767.1.77779 WP_000615767.1.77785 WP_000615767.1.77789 WP_000615767.1.77808 WP_000615767.1.77870 WP_000615767.1.77894 WP_000615767.1.77906 WP_000615767.1.77912 WP_000615767.1.77976 WP_000615767.1.77982 WP_000615767.1.78003 WP_000615767.1.78025 WP_000615767.1.78030 WP_000615767.1.78068 WP_000615767.1.78078 WP_000615767.1.78079 WP_000615767.1.78087 WP_000615767.1.78108 WP_000615767.1.7812 WP_000615767.1.78129 WP_000615767.1.7813 WP_000615767.1.78147 WP_000615767.1.7822 WP_000615767.1.78241 WP_000615767.1.78253 WP_000615767.1.78270 WP_000615767.1.78312 WP_000615767.1.78318 WP_000615767.1.7838 WP_000615767.1.78395 WP_000615767.1.78422 WP_000615767.1.78444 WP_000615767.1.78454 WP_000615767.1.78455 WP_000615767.1.78475 WP_000615767.1.78541 WP_000615767.1.78546 WP_000615767.1.78563 WP_000615767.1.78569 WP_000615767.1.78609 WP_000615767.1.78656 WP_000615767.1.78710 WP_000615767.1.78733 WP_000615767.1.78755 WP_000615767.1.7876 WP_000615767.1.78794 WP_000615767.1.78796 WP_000615767.1.78865 WP_000615767.1.78870 WP_000615767.1.78876 WP_000615767.1.78887 WP_000615767.1.78915 WP_000615767.1.78939 WP_000615767.1.78965 WP_000615767.1.78967 WP_000615767.1.78979 WP_000615767.1.79040 WP_000615767.1.79079 WP_000615767.1.79080 WP_000615767.1.79096 WP_000615767.1.79104 WP_000615767.1.79124 WP_000615767.1.7915 WP_000615767.1.79157 WP_000615767.1.79169 WP_000615767.1.79187 WP_000615767.1.7924 WP_000615767.1.79316 WP_000615767.1.79329 WP_000615767.1.79338 WP_000615767.1.79349 WP_000615767.1.79410 WP_000615767.1.7950 WP_000615767.1.79527 WP_000615767.1.7954 WP_000615767.1.79546 WP_000615767.1.79594 WP_000615767.1.79612 WP_000615767.1.79616 WP_000615767.1.79671 WP_000615767.1.79688 WP_000615767.1.79746 WP_000615767.1.79748 WP_000615767.1.79767 WP_000615767.1.79793 WP_000615767.1.798 WP_000615767.1.79809 WP_000615767.1.79811 WP_000615767.1.79830 WP_000615767.1.79835 WP_000615767.1.79858 WP_000615767.1.79899 WP_000615767.1.79940 WP_000615767.1.7998 WP_000615767.1.800 WP_000615767.1.80005 WP_000615767.1.80019 WP_000615767.1.80049 WP_000615767.1.80070 WP_000615767.1.80093 WP_000615767.1.80130 WP_000615767.1.80148 WP_000615767.1.80161 WP_000615767.1.80196 WP_000615767.1.80200 WP_000615767.1.80207 WP_000615767.1.80211 WP_000615767.1.80248 WP_000615767.1.80251 WP_000615767.1.80279 WP_000615767.1.80294 WP_000615767.1.80314 WP_000615767.1.80357 WP_000615767.1.80364 WP_000615767.1.80367 WP_000615767.1.80373 WP_000615767.1.80376 WP_000615767.1.8041 WP_000615767.1.80427 WP_000615767.1.80435 WP_000615767.1.80457 WP_000615767.1.80467 WP_000615767.1.80495 WP_000615767.1.80516 WP_000615767.1.80532 WP_000615767.1.80539 WP_000615767.1.80548 WP_000615767.1.80557 WP_000615767.1.80596 WP_000615767.1.80597 WP_000615767.1.80611 WP_000615767.1.80613 WP_000615767.1.80689 WP_000615767.1.80691 WP_000615767.1.80700 WP_000615767.1.80765 WP_000615767.1.80774 WP_000615767.1.80775 WP_000615767.1.80875 WP_000615767.1.80903 WP_000615767.1.80914 WP_000615767.1.80949 WP_000615767.1.80951 WP_000615767.1.80971 WP_000615767.1.80996 WP_000615767.1.81033 WP_000615767.1.81048 WP_000615767.1.8109 WP_000615767.1.81090 WP_000615767.1.81117 WP_000615767.1.81183 WP_000615767.1.81201 WP_000615767.1.81236 WP_000615767.1.81292 WP_000615767.1.81296 WP_000615767.1.81309 WP_000615767.1.81343 WP_000615767.1.81360 WP_000615767.1.81367 WP_000615767.1.81369 WP_000615767.1.81375 WP_000615767.1.81390 WP_000615767.1.81395 WP_000615767.1.81408 WP_000615767.1.81473 WP_000615767.1.81483 WP_000615767.1.81492 WP_000615767.1.81493 WP_000615767.1.81498 WP_000615767.1.815 WP_000615767.1.81530 WP_000615767.1.81533 WP_000615767.1.8154 WP_000615767.1.81550 WP_000615767.1.81586 WP_000615767.1.81587 WP_000615767.1.81616 WP_000615767.1.81630 WP_000615767.1.81639 WP_000615767.1.81677 WP_000615767.1.81694 WP_000615767.1.81703 WP_000615767.1.81707 WP_000615767.1.81716 WP_000615767.1.81724 WP_000615767.1.81729 WP_000615767.1.81733 WP_000615767.1.81769 WP_000615767.1.81775 WP_000615767.1.81781 WP_000615767.1.81801 WP_000615767.1.81817 WP_000615767.1.81857 WP_000615767.1.81929 WP_000615767.1.81962 WP_000615767.1.82005 WP_000615767.1.82042 WP_000615767.1.82051 WP_000615767.1.82140 WP_000615767.1.82195 WP_000615767.1.8221 WP_000615767.1.82213 WP_000615767.1.82252 WP_000615767.1.82284 WP_000615767.1.82297 WP_000615767.1.82298 WP_000615767.1.82306 WP_000615767.1.82342 WP_000615767.1.82345 WP_000615767.1.82353 WP_000615767.1.82386 WP_000615767.1.82425 WP_000615767.1.82437 WP_000615767.1.82459 WP_000615767.1.8248 WP_000615767.1.82505 WP_000615767.1.82518 WP_000615767.1.82537 WP_000615767.1.82564 WP_000615767.1.82603 WP_000615767.1.82652 WP_000615767.1.82660 WP_000615767.1.82666 WP_000615767.1.82693 WP_000615767.1.82699 WP_000615767.1.82732 WP_000615767.1.82736 WP_000615767.1.82737 WP_000615767.1.8275 WP_000615767.1.82750 WP_000615767.1.82771 WP_000615767.1.82792 WP_000615767.1.82818 WP_000615767.1.8283 WP_000615767.1.82839 WP_000615767.1.82840 WP_000615767.1.82845 WP_000615767.1.82869 WP_000615767.1.82877 WP_000615767.1.82885 WP_000615767.1.82900 WP_000615767.1.82911 WP_000615767.1.82918 WP_000615767.1.82921 WP_000615767.1.82929 WP_000615767.1.82971 WP_000615767.1.82985 WP_000615767.1.83042 WP_000615767.1.83064 WP_000615767.1.83067 WP_000615767.1.83094 WP_000615767.1.83111 WP_000615767.1.83123 WP_000615767.1.83135 WP_000615767.1.83136 WP_000615767.1.8315 WP_000615767.1.83158 WP_000615767.1.83164 WP_000615767.1.83183 WP_000615767.1.83199 WP_000615767.1.83219 WP_000615767.1.83231 WP_000615767.1.83239 WP_000615767.1.83241 WP_000615767.1.83242 WP_000615767.1.83244 WP_000615767.1.83278 WP_000615767.1.83306 WP_000615767.1.83311 WP_000615767.1.83319 WP_000615767.1.83324 WP_000615767.1.83403 WP_000615767.1.83414 WP_000615767.1.83439 WP_000615767.1.83446 WP_000615767.1.83455 WP_000615767.1.83456 WP_000615767.1.8347 WP_000615767.1.83471 WP_000615767.1.83489 WP_000615767.1.83518 WP_000615767.1.83565 WP_000615767.1.83574 WP_000615767.1.83577 WP_000615767.1.83578 WP_000615767.1.83586 WP_000615767.1.83587 WP_000615767.1.8360 WP_000615767.1.83604 WP_000615767.1.83606 WP_000615767.1.83613 WP_000615767.1.83681 WP_000615767.1.83702 WP_000615767.1.83713 WP_000615767.1.83726 WP_000615767.1.83730 WP_000615767.1.83732 WP_000615767.1.83789 WP_000615767.1.83790 WP_000615767.1.83796 WP_000615767.1.83843 WP_000615767.1.83846 WP_000615767.1.83863 WP_000615767.1.83866 WP_000615767.1.83888 WP_000615767.1.83898 WP_000615767.1.83916 WP_000615767.1.8392 WP_000615767.1.83922 WP_000615767.1.83963 WP_000615767.1.8398 WP_000615767.1.84013 WP_000615767.1.84017 WP_000615767.1.84038 WP_000615767.1.84052 WP_000615767.1.84065 WP_000615767.1.84092 WP_000615767.1.84116 WP_000615767.1.84125 WP_000615767.1.84147 WP_000615767.1.8416 WP_000615767.1.84182 WP_000615767.1.84213 WP_000615767.1.84225 WP_000615767.1.84292 WP_000615767.1.84305 WP_000615767.1.84321 WP_000615767.1.84353 WP_000615767.1.8438 WP_000615767.1.84444 WP_000615767.1.84500 WP_000615767.1.84505 WP_000615767.1.84513 WP_000615767.1.84552 WP_000615767.1.84576 WP_000615767.1.846 WP_000615767.1.84613 WP_000615767.1.84633 WP_000615767.1.84636 WP_000615767.1.84640 WP_000615767.1.84643 WP_000615767.1.84658 WP_000615767.1.84669 WP_000615767.1.84724 WP_000615767.1.84746 WP_000615767.1.84747 WP_000615767.1.84785 WP_000615767.1.8481 WP_000615767.1.84842 WP_000615767.1.84858 WP_000615767.1.84931 WP_000615767.1.84955 WP_000615767.1.84998 WP_000615767.1.85019 WP_000615767.1.85021 WP_000615767.1.85033 WP_000615767.1.8506 WP_000615767.1.85061 WP_000615767.1.85062 WP_000615767.1.85093 WP_000615767.1.85095 WP_000615767.1.8510 WP_000615767.1.85103 WP_000615767.1.85123 WP_000615767.1.85171 WP_000615767.1.85212 WP_000615767.1.85222 WP_000615767.1.85233 WP_000615767.1.8524 WP_000615767.1.85258 WP_000615767.1.85286 WP_000615767.1.8534 WP_000615767.1.85373 WP_000615767.1.85379 WP_000615767.1.85393 WP_000615767.1.85418 WP_000615767.1.85427 WP_000615767.1.85434 WP_000615767.1.85452 WP_000615767.1.8547 WP_000615767.1.85470 WP_000615767.1.85494 WP_000615767.1.85496 WP_000615767.1.85508 WP_000615767.1.85522 WP_000615767.1.85526 WP_000615767.1.85552 WP_000615767.1.85588 WP_000615767.1.85608 WP_000615767.1.85609 WP_000615767.1.85613 WP_000615767.1.85624 WP_000615767.1.85652 WP_000615767.1.85659 WP_000615767.1.85661 WP_000615767.1.8569 WP_000615767.1.85718 WP_000615767.1.8574 WP_000615767.1.85745 WP_000615767.1.85748 WP_000615767.1.85760 WP_000615767.1.85826 WP_000615767.1.85849 WP_000615767.1.85861 WP_000615767.1.85869 WP_000615767.1.85880 WP_000615767.1.85882 WP_000615767.1.8590 WP_000615767.1.85907 WP_000615767.1.85918 WP_000615767.1.85947 WP_000615767.1.85962 WP_000615767.1.85973 WP_000615767.1.86013 WP_000615767.1.86040 WP_000615767.1.86081 WP_000615767.1.86112 WP_000615767.1.8618 WP_000615767.1.86211 WP_000615767.1.86296 WP_000615767.1.86297 WP_000615767.1.86300 WP_000615767.1.86313 WP_000615767.1.86320 WP_000615767.1.86326 WP_000615767.1.86330 WP_000615767.1.86346 WP_000615767.1.86360 WP_000615767.1.86403 WP_000615767.1.86423 WP_000615767.1.86440 WP_000615767.1.86457 WP_000615767.1.8646 WP_000615767.1.86503 WP_000615767.1.86558 WP_000615767.1.86559 WP_000615767.1.86612 WP_000615767.1.86632 WP_000615767.1.86636 WP_000615767.1.86655 WP_000615767.1.86659 WP_000615767.1.86685 WP_000615767.1.86702 WP_000615767.1.86721 WP_000615767.1.86722 WP_000615767.1.86723 WP_000615767.1.86724 WP_000615767.1.8674 WP_000615767.1.86742 WP_000615767.1.86746 WP_000615767.1.86747 WP_000615767.1.86784 WP_000615767.1.86812 WP_000615767.1.86841 WP_000615767.1.86880 WP_000615767.1.86887 WP_000615767.1.86913 WP_000615767.1.86918 WP_000615767.1.87069 WP_000615767.1.87073 WP_000615767.1.87077 WP_000615767.1.8708 WP_000615767.1.87084 WP_000615767.1.87094 WP_000615767.1.87118 WP_000615767.1.87135 WP_000615767.1.87160 WP_000615767.1.87229 WP_000615767.1.8724 WP_000615767.1.87248 WP_000615767.1.87289 WP_000615767.1.87317 WP_000615767.1.87331 WP_000615767.1.87347 WP_000615767.1.87421 WP_000615767.1.8744 WP_000615767.1.87510 WP_000615767.1.87521 WP_000615767.1.87548 WP_000615767.1.87550 WP_000615767.1.87592 WP_000615767.1.87621 WP_000615767.1.87664 WP_000615767.1.87699 WP_000615767.1.87731 WP_000615767.1.87774 WP_000615767.1.87792 WP_000615767.1.87799 WP_000615767.1.87815 WP_000615767.1.87824 WP_000615767.1.87833 WP_000615767.1.87872 WP_000615767.1.87901 WP_000615767.1.87909 WP_000615767.1.87910 WP_000615767.1.87922 WP_000615767.1.87942 WP_000615767.1.87946 WP_000615767.1.87961 WP_000615767.1.87969 WP_000615767.1.87971 WP_000615767.1.8799 WP_000615767.1.87993 WP_000615767.1.87998 WP_000615767.1.88008 WP_000615767.1.88054 WP_000615767.1.88056 WP_000615767.1.88103 WP_000615767.1.88113 WP_000615767.1.88129 WP_000615767.1.88141 WP_000615767.1.88167 WP_000615767.1.88170 WP_000615767.1.88172 WP_000615767.1.8818 WP_000615767.1.88182 WP_000615767.1.88196 WP_000615767.1.88224 WP_000615767.1.88225 WP_000615767.1.88228 WP_000615767.1.88232 WP_000615767.1.88254 WP_000615767.1.883 WP_000615767.1.88365 WP_000615767.1.88391 WP_000615767.1.88433 WP_000615767.1.88488 WP_000615767.1.88544 WP_000615767.1.8858 WP_000615767.1.88652 WP_000615767.1.88669 WP_000615767.1.88697 WP_000615767.1.88699 WP_000615767.1.88716 WP_000615767.1.88825 WP_000615767.1.88841 WP_000615767.1.88869 WP_000615767.1.88904 WP_000615767.1.88932 WP_000615767.1.88939 WP_000615767.1.88940 WP_000615767.1.88955 WP_000615767.1.88984 WP_000615767.1.89034 WP_000615767.1.89057 WP_000615767.1.89059 WP_000615767.1.89094 WP_000615767.1.8914 WP_000615767.1.89208 WP_000615767.1.89224 WP_000615767.1.89253 WP_000615767.1.89254 WP_000615767.1.8926 WP_000615767.1.89282 WP_000615767.1.89294 WP_000615767.1.89310 WP_000615767.1.89369 WP_000615767.1.89442 WP_000615767.1.89444 WP_000615767.1.89446 WP_000615767.1.89489 WP_000615767.1.89525 WP_000615767.1.89532 WP_000615767.1.89539 WP_000615767.1.89565 WP_000615767.1.89585 WP_000615767.1.89624 WP_000615767.1.89640 WP_000615767.1.89649 WP_000615767.1.89652 WP_000615767.1.89658 WP_000615767.1.89684 WP_000615767.1.8970 WP_000615767.1.89757 WP_000615767.1.89763 WP_000615767.1.89806 WP_000615767.1.89828 WP_000615767.1.89850 WP_000615767.1.89858 WP_000615767.1.89864 WP_000615767.1.89881 WP_000615767.1.89887 WP_000615767.1.89891 WP_000615767.1.89907 WP_000615767.1.89942 WP_000615767.1.89945 WP_000615767.1.89982 WP_000615767.1.90001 WP_000615767.1.90035 WP_000615767.1.90053 WP_000615767.1.90113 WP_000615767.1.90124 WP_000615767.1.90143 WP_000615767.1.90158 WP_000615767.1.90166 WP_000615767.1.90192 WP_000615767.1.90197 WP_000615767.1.90202 WP_000615767.1.9027 WP_000615767.1.90313 WP_000615767.1.90339 WP_000615767.1.90385 WP_000615767.1.90397 WP_000615767.1.9045 WP_000615767.1.90482 WP_000615767.1.90486 WP_000615767.1.90501 WP_000615767.1.90529 WP_000615767.1.90535 WP_000615767.1.90539 WP_000615767.1.9057 WP_000615767.1.90577 WP_000615767.1.90583 WP_000615767.1.90615 WP_000615767.1.90618 WP_000615767.1.90663 WP_000615767.1.90676 WP_000615767.1.90695 WP_000615767.1.90712 WP_000615767.1.90727 WP_000615767.1.90731 WP_000615767.1.90733 WP_000615767.1.90768 WP_000615767.1.90776 WP_000615767.1.90778 WP_000615767.1.90809 WP_000615767.1.90869 WP_000615767.1.90882 WP_000615767.1.90897 WP_000615767.1.90925 WP_000615767.1.90927 WP_000615767.1.90957 WP_000615767.1.90970 WP_000615767.1.90980 WP_000615767.1.90989 WP_000615767.1.91015 WP_000615767.1.91024 WP_000615767.1.91034 WP_000615767.1.91041 WP_000615767.1.91052 WP_000615767.1.91079 WP_000615767.1.9108 WP_000615767.1.91149 WP_000615767.1.9115 WP_000615767.1.91154 WP_000615767.1.91176 WP_000615767.1.91178 WP_000615767.1.91193 WP_000615767.1.91271 WP_000615767.1.91276 WP_000615767.1.91321 WP_000615767.1.91339 WP_000615767.1.91369 WP_000615767.1.91375 WP_000615767.1.91388 WP_000615767.1.91407 WP_000615767.1.91413 WP_000615767.1.91432 WP_000615767.1.9146 WP_000615767.1.91468 WP_000615767.1.91481 WP_000615767.1.91562 WP_000615767.1.91650 WP_000615767.1.91656 WP_000615767.1.91686 WP_000615767.1.91705 WP_000615767.1.91714 WP_000615767.1.91718 WP_000615767.1.9173 WP_000615767.1.91733 WP_000615767.1.91775 WP_000615767.1.91811 WP_000615767.1.91815 WP_000615767.1.9184 WP_000615767.1.91878 WP_000615767.1.91886 WP_000615767.1.91888 WP_000615767.1.9192 WP_000615767.1.91924 WP_000615767.1.91934 WP_000615767.1.91947 WP_000615767.1.91949 WP_000615767.1.91972 WP_000615767.1.91985 WP_000615767.1.92006 WP_000615767.1.92010 WP_000615767.1.92015 WP_000615767.1.92027 WP_000615767.1.92034 WP_000615767.1.92045 WP_000615767.1.92065 WP_000615767.1.9207 WP_000615767.1.92092 WP_000615767.1.92103 WP_000615767.1.92121 WP_000615767.1.92124 WP_000615767.1.92166 WP_000615767.1.92168 WP_000615767.1.92177 WP_000615767.1.92178 WP_000615767.1.92182 WP_000615767.1.92187 WP_000615767.1.92225 WP_000615767.1.92245 WP_000615767.1.9225 WP_000615767.1.92298 WP_000615767.1.92301 WP_000615767.1.92326 WP_000615767.1.92353 WP_000615767.1.92369 WP_000615767.1.92381 WP_000615767.1.92386 WP_000615767.1.92400 WP_000615767.1.92457 WP_000615767.1.92464 WP_000615767.1.92487 WP_000615767.1.92491 WP_000615767.1.92563 WP_000615767.1.92564 WP_000615767.1.9260 WP_000615767.1.92631 WP_000615767.1.92652 WP_000615767.1.92682 WP_000615767.1.92724 WP_000615767.1.9275 WP_000615767.1.92755 WP_000615767.1.92814 WP_000615767.1.92854 WP_000615767.1.92872 WP_000615767.1.92874 WP_000615767.1.92962 WP_000615767.1.92969 WP_000615767.1.9297 WP_000615767.1.9299 WP_000615767.1.93021 WP_000615767.1.93075 WP_000615767.1.93084 WP_000615767.1.93108 WP_000615767.1.93126 WP_000615767.1.93135 WP_000615767.1.93152 WP_000615767.1.93154 WP_000615767.1.93156 WP_000615767.1.93173 WP_000615767.1.93183 WP_000615767.1.93238 WP_000615767.1.93253 WP_000615767.1.93262 WP_000615767.1.93274 WP_000615767.1.93294 WP_000615767.1.93311 WP_000615767.1.9332 WP_000615767.1.93347 WP_000615767.1.9339 WP_000615767.1.93401 WP_000615767.1.93442 WP_000615767.1.9345 WP_000615767.1.93452 WP_000615767.1.9347 WP_000615767.1.93474 WP_000615767.1.93475 WP_000615767.1.93479 WP_000615767.1.93489 WP_000615767.1.93496 WP_000615767.1.93506 WP_000615767.1.93522 WP_000615767.1.93548 WP_000615767.1.93592 WP_000615767.1.93606 WP_000615767.1.93636 WP_000615767.1.9364 WP_000615767.1.9369 WP_000615767.1.93696 WP_000615767.1.93700 WP_000615767.1.93720 WP_000615767.1.93773 WP_000615767.1.93785 WP_000615767.1.93786 WP_000615767.1.93814 WP_000615767.1.93835 WP_000615767.1.93869 WP_000615767.1.93902 WP_000615767.1.93906 WP_000615767.1.93910 WP_000615767.1.93915 WP_000615767.1.93947 WP_000615767.1.93974 WP_000615767.1.93982 WP_000615767.1.93992 WP_000615767.1.94024 WP_000615767.1.94029 WP_000615767.1.9403 WP_000615767.1.94061 WP_000615767.1.94068 WP_000615767.1.94098 WP_000615767.1.94139 WP_000615767.1.94157 WP_000615767.1.94159 WP_000615767.1.94192 WP_000615767.1.94195 WP_000615767.1.94247 WP_000615767.1.94260 WP_000615767.1.94269 WP_000615767.1.94274 WP_000615767.1.9429 WP_000615767.1.94334 WP_000615767.1.94369 WP_000615767.1.94395 WP_000615767.1.94425 WP_000615767.1.94459 WP_000615767.1.94469 WP_000615767.1.94476 WP_000615767.1.945 WP_000615767.1.94509 WP_000615767.1.94515 WP_000615767.1.94526 WP_000615767.1.94538 WP_000615767.1.94539 WP_000615767.1.94559 WP_000615767.1.9458 WP_000615767.1.94595 WP_000615767.1.94604 WP_000615767.1.94610 WP_000615767.1.94643 WP_000615767.1.94644 WP_000615767.1.94708 WP_000615767.1.94724 WP_000615767.1.94771 WP_000615767.1.94778 WP_000615767.1.94810 WP_000615767.1.9483 WP_000615767.1.94876 WP_000615767.1.94885 WP_000615767.1.95013 WP_000615767.1.95041 WP_000615767.1.95113 WP_000615767.1.95125 WP_000615767.1.95128 WP_000615767.1.95177 WP_000615767.1.95208 WP_000615767.1.95219 WP_000615767.1.95251 WP_000615767.1.95258 WP_000615767.1.95264 WP_000615767.1.95276 WP_000615767.1.953 WP_000615767.1.95312 WP_000615767.1.95321 WP_000615767.1.95322 WP_000615767.1.95333 WP_000615767.1.95334 WP_000615767.1.95369 WP_000615767.1.95376 WP_000615767.1.95458 WP_000615767.1.95468 WP_000615767.1.95479 WP_000615767.1.9549 WP_000615767.1.95528 WP_000615767.1.95531 WP_000615767.1.95553 WP_000615767.1.95605 WP_000615767.1.95621 WP_000615767.1.95688 WP_000615767.1.95698 WP_000615767.1.95707 WP_000615767.1.95736 WP_000615767.1.95762 WP_000615767.1.95853 WP_000615767.1.95856 WP_000615767.1.95870 WP_000615767.1.95876 WP_000615767.1.95904 WP_000615767.1.9592 WP_000615767.1.95936 WP_000615767.1.95968 WP_000615767.1.95992 WP_000615767.1.95998 WP_000615767.1.96011 WP_000615767.1.96012 WP_000615767.1.96081 WP_000615767.1.96109 WP_000615767.1.96111 WP_000615767.1.96120 WP_000615767.1.9615 WP_000615767.1.96181 WP_000615767.1.96205 WP_000615767.1.9621 WP_000615767.1.96231 WP_000615767.1.96244 WP_000615767.1.96249 WP_000615767.1.96277 WP_000615767.1.96292 WP_000615767.1.96307 WP_000615767.1.96309 WP_000615767.1.96321 WP_000615767.1.96336 WP_000615767.1.96350 WP_000615767.1.96421 WP_000615767.1.96432 WP_000615767.1.96448 WP_000615767.1.96466 WP_000615767.1.96564 WP_000615767.1.96582 WP_000615767.1.96595 WP_000615767.1.966 WP_000615767.1.96619 WP_000615767.1.9662 WP_000615767.1.96629 WP_000615767.1.96636 WP_000615767.1.96703 WP_000615767.1.96709 WP_000615767.1.96728 WP_000615767.1.96772 WP_000615767.1.96785 WP_000615767.1.96791 WP_000615767.1.96812 WP_000615767.1.96819 WP_000615767.1.96833 WP_000615767.1.96851 WP_000615767.1.96858 WP_000615767.1.96872 WP_000615767.1.96873 WP_000615767.1.96887 WP_000615767.1.96889 WP_000615767.1.96899 WP_000615767.1.96939 WP_000615767.1.96958 WP_000615767.1.96961 WP_000615767.1.97035 WP_000615767.1.97040 WP_000615767.1.97045 WP_000615767.1.97046 WP_000615767.1.97048 WP_000615767.1.9705 WP_000615767.1.97051 WP_000615767.1.97066 WP_000615767.1.97091 WP_000615767.1.971 WP_000615767.1.97158 WP_000615767.1.97210 WP_000615767.1.97252 WP_000615767.1.97254 WP_000615767.1.97265 WP_000615767.1.9727 WP_000615767.1.97284 WP_000615767.1.97308 WP_000615767.1.97362 WP_000615767.1.97381 WP_000615767.1.97410 WP_000615767.1.97442 WP_000615767.1.97476 WP_000615767.1.97479 WP_000615767.1.97482 WP_000615767.1.97485 WP_000615767.1.97553 WP_000615767.1.97556 WP_000615767.1.9757 WP_000615767.1.97570 WP_000615767.1.97582 WP_000615767.1.97644 WP_000615767.1.97658 WP_000615767.1.97702 WP_000615767.1.97733 WP_000615767.1.97738 WP_000615767.1.97808 WP_000615767.1.97824 WP_000615767.1.97829 WP_000615767.1.97831 WP_000615767.1.97856 WP_000615767.1.97862 WP_000615767.1.97866 WP_000615767.1.97875 WP_000615767.1.97879 WP_000615767.1.97880 WP_000615767.1.97891 WP_000615767.1.97892 WP_000615767.1.97901 WP_000615767.1.97931 WP_000615767.1.98044 WP_000615767.1.98049 WP_000615767.1.98084 WP_000615767.1.98094 WP_000615767.1.9812 WP_000615767.1.98168 WP_000615767.1.9819 WP_000615767.1.98192 WP_000615767.1.98196 WP_000615767.1.98217 WP_000615767.1.98234 WP_000615767.1.98259 WP_000615767.1.98270 WP_000615767.1.98273 WP_000615767.1.98277 WP_000615767.1.98286 WP_000615767.1.98288 WP_000615767.1.98319 WP_000615767.1.98376 WP_000615767.1.98398 WP_000615767.1.98399 WP_000615767.1.98427 WP_000615767.1.98435 WP_000615767.1.98449 WP_000615767.1.98475 WP_000615767.1.98504 WP_000615767.1.98518 WP_000615767.1.98539 WP_000615767.1.98545 WP_000615767.1.98589 WP_000615767.1.98623 WP_000615767.1.98632 WP_000615767.1.98635 WP_000615767.1.98647 WP_000615767.1.98648 WP_000615767.1.98740 WP_000615767.1.98755 WP_000615767.1.98759 WP_000615767.1.98787 WP_000615767.1.98896 WP_000615767.1.98915 WP_000615767.1.98961 WP_000615767.1.98990 WP_000615767.1.99001 WP_000615767.1.99010 WP_000615767.1.9902 WP_000615767.1.99066 WP_000615767.1.99096 WP_000615767.1.99126 WP_000615767.1.99148 WP_000615767.1.9915 WP_000615767.1.99181 WP_000615767.1.99202 WP_000615767.1.99291 WP_000615767.1.99301 WP_000615767.1.9931 WP_000615767.1.99313 WP_000615767.1.99342 WP_000615767.1.99364 WP_000615767.1.99371 WP_000615767.1.99387 WP_000615767.1.99465 WP_000615767.1.99502 WP_000615767.1.99547 WP_000615767.1.99554 WP_000615767.1.99574 WP_000615767.1.99593 WP_000615767.1.99596 WP_000615767.1.99606 WP_000615767.1.99640 WP_000615767.1.99669 WP_000615767.1.99678 WP_000615767.1.99680 WP_000615767.1.99685 WP_000615767.1.99687 WP_000615767.1.9969 WP_000615767.1.997 WP_000615767.1.99732 WP_000615767.1.99781 WP_000615767.1.99787 WP_000615767.1.99790 WP_000615767.1.99793 WP_000615767.1.9984 WP_000615767.1.99853 WP_000615767.1.99879 WP_000615767.1.999 WP_000615767.1.99900 WP_000615767.1.99980 171101.spr1727 373153.SPD_1714 487213.SPT_1860 487214.SPH_2055 488221.SP70585_1992 488222.SPJ_1906 488223.SPP_1940 512566.SPG_1823 516950.SPCG_1886 561276.SPN23F_19350 gi|480532863|ref|YP_007765066.1| gi|225857499|ref|YP_002739010.1| gi|387788934|ref|YP_006254002.1| gi|298503648|ref|YP_003725588.1| gi|225861704|ref|YP_002743213.1| gi|387627084|ref|YP_006063260.1| gi|410477263|ref|YP_006744022.1| gi|225859677|ref|YP_002741187.1| gi|194396919|ref|YP_002038505.1| gi|116517084|ref|YP_817140.1| gi|221232645|ref|YP_002511799.1| gi|556561603|ref|YP_008730963.1| gi|182684856|ref|YP_001836603.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]