SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256376122|ref|YP_003099782.1| from Actinosynnema mirum DSM 43827

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256376122|ref|YP_003099782.1|
Domain Number 1 Region: 6-77
Classification Level Classification E-value
Superfamily Homeodomain-like 3.37e-16
Family Tetracyclin repressor-like, N-terminal domain 0.0099
Further Details:      
 
Domain Number 2 Region: 81-181
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.0000017
Family Tetracyclin repressor-like, C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256376122|ref|YP_003099782.1|
Sequence length 181
Comment TetR family transcriptional regulator [Actinosynnema mirum DSM 43827]
Sequence
MPPARRADALVNRERILEVARDALAESGCASLNSIAKRACVGAGTLYRHFPTREELVLAV
YRHEVQRLVDRAPRLLAEVGPEEAFRRWASGLAGYVKVKHGLGEAFSAATRENLVSESYA
QVSAAVAALLAAGTSAGVFREGLAADDVLLLMGGMWRVPPGPDGERQAERVLGLVVAALR
A
Download sequence
Identical sequences C6WFK1
gi|256376122|ref|YP_003099782.1| WP_015800825.1.52053 446462.Amir_1988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]