SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256377957|ref|YP_003101617.1| from Actinosynnema mirum DSM 43827

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256377957|ref|YP_003101617.1|
Domain Number 1 Region: 3-396
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 2.86e-78
Family Gtf glycosyltransferase 0.0000000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256377957|ref|YP_003101617.1|
Sequence length 397
Comment glycosyl transferase family protein [Actinosynnema mirum DSM 43827]
Sequence
MTRVLLSTYGTRGDVEPLLALAVELRALDAEVRVCAPPDAEFARRLAGLGIDAVPVGPPI
RALMSGTTPPSAAELSRYRAELVDAQFSVLPSAVAGCDALVVAGLAQVAARSVAEAAGIR
YAYATYAAVNLPSPHHAPPPRPGWPEPEGDNTTRWRLDADLVDAQFREPLNRHRAALGLP
PVAAVRDHVHSDRPWLAADPLLGPWPPGHDLEVVQTGAWTAVDERPLPADLVEFLAAGAP
PVYVGFGSIGPVPGVARSAVEAGRARGHRVLVSRGWADLDVVDGQDDCFAVGDVNHQRLF
GELAAVIHHGGAGTTHTAARAGVPQVVVPIQVADNPYWAGQVAACGIGVALDGRTATAQT
LAAALETALAPETRDRARALGAGIRTDGARRAARLLL
Download sequence
Identical sequences C6WEH1
446462.Amir_3897 WP_015802658.1.52053 gi|256377957|ref|YP_003101617.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]