SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256378764|ref|YP_003102424.1| from Actinosynnema mirum DSM 43827

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256378764|ref|YP_003102424.1|
Domain Number 1 Region: 18-180
Classification Level Classification E-value
Superfamily Formate/glycerate dehydrogenase catalytic domain-like 2.98e-45
Family L-alanine dehydrogenase-like 0.00018
Further Details:      
 
Domain Number 2 Region: 150-325
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 8.26e-37
Family Formate/glycerate dehydrogenases, NAD-domain 0.0000127
Further Details:      
 
Weak hits

Sequence:  gi|256378764|ref|YP_003102424.1|
Domain Number - Region: 308-373
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.0378
Family Tetracyclin repressor-like, C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256378764|ref|YP_003102424.1|
Sequence length 373
Comment alanine dehydrogenase/PNT domain-containing protein [Actinosynnema mirum DSM 43827]
Sequence
MDTALSTGEGGASGAVVRVGVVRESTGGERRVALVPGAVAELVGRGIDVVVESGAGDGSL
LPDGLYSAAGAAIGDAWAADVVVKVAPPTAEEVTRLRSGQVLIGFLAPRGADNRIGELDA
AGVRAFAVESIPRISRAQAMDALSSQANVAGYRAVLLAASLSTRFFPMLTTAAGTVKPAS
ALVLGVGVAGLQALATAKRLGARTTGYDVRPEVAEQVRSVGAKWLDLGIDAAGEGGYARE
LTEQERDTQQKELEKAISGFDVVITTALVPGMPAPRLVTAAAVEGMRPGSVVVDLAGETG
GNCELTEPGQTVVRHGVTVASPLNLPATMPEHASELYAKNVTSLLELLITDGALAPDLDD
EIVAGALVTGKEG
Download sequence
Identical sequences C6WP76
gi|256378764|ref|YP_003102424.1| 446462.Amir_4749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]