SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256378640|ref|YP_003102300.1| from Actinosynnema mirum DSM 43827

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256378640|ref|YP_003102300.1|
Domain Number 1 Region: 356-491
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.41e-39
Family Ricin B-like 0.00074
Further Details:      
 
Domain Number 2 Region: 45-323
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.47e-30
Family beta-glycanases 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256378640|ref|YP_003102300.1|
Sequence length 497
Comment Ricin B lectin [Actinosynnema mirum DSM 43827]
Sequence
MDRRADQVSGSPTAAPRPLALVVAALTALACLAAPAPEARAATNQFRGVNWAVLGDNFST
TALVPQGLSRSDSNATVRAKANALYDDLAATLGVNTVRLPVNTHTVADTTWWNAYRGAID
AATARGFKVILAYWEDGAASGGRITNTSAWNSMWATVVGAYASHGGVYFEPMNEPHGYTS
AQWRDVAAGWLATHASAPPGRVLIGGTGYSQDLRDVCGDSRFASTLLSFHHYAFFYEAMT
YDAFRGHIQTRLGSCASRAVATEFGAPMSTGLDYGNAGSTDNFVRHIRAMAQVMRDNGMG
GTYWPALGGKPTGNLGYDSYSLYALSGGGTDLNLTVRNASGADRLRYAWGDGSTPPTTNY
RVDVRHSGKSMDVQQPNGDNGARVGQYAYGGNPWQQWQFQDAGGGHWRIVSRNSGRCLDV
VSASTADGAELVQYTCGSGTNQEFQLVASGSHFQLKARHSGKCVDVPSSSTADGVVLKQY
PCNGGANQQWTRTAVTG
Download sequence
Identical sequences C6WMU1
WP_015803341.1.52053 446462.Amir_4621 gi|256378640|ref|YP_003102300.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]