SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256379547|ref|YP_003103207.1| from Actinosynnema mirum DSM 43827

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256379547|ref|YP_003103207.1|
Domain Number 1 Region: 163-426
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 6.28e-33
Family Bacterial PLC 0.023
Further Details:      
 
Domain Number 2 Region: 47-138
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.0000035
Family Ricin B-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256379547|ref|YP_003103207.1|
Sequence length 438
Comment hypothetical protein Amir_5543 [Actinosynnema mirum DSM 43827]
Sequence
MRLPALAVTALLVAALPATALASPNTPAPPNTVAPQNTLAAAESGLHYLQSATNGLNASA
SASPVPLRRPKGNEDRQQWNVVGDTLQEGGRCLGRSGDQAVLLACDSADARWEVVADGAS
RVLKVPGQNRYLTTEGEQARVGTRRDTWFLNPVSPTRVAVPQDGSRRLDQVTFLTAHNAY
ANGVDGGFAPPFVNLAPNQARGVEQQLADGVRAFQLDIHQTPDGAILCHNSCTLVSGPVA
LNVDLRRLVDFLGRNPSEVVTVFLEDYVSVDVLRAELAKVPGLANVLFRPDQAGVRQNGW
PTLDALRASGKRLLIFSDEPGRDSLGAMFQPDWTVENYWSMGAGVGSSDWSCYSRWSTPL
TRTEPGFTPLFVMNHFRDVPFTGTATSDNGKLADRARRFCEPAARKTPNYLAVDHYHLGN
ALSAVAELSRDRFQASTR
Download sequence
Identical sequences C6WB70
446462.Amir_5543 gi|256379547|ref|YP_003103207.1| WP_015804246.1.52053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]