SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474933655|ref|YP_007687237.1| from Thermoplasmatales archaeon BRNA1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474933655|ref|YP_007687237.1|
Domain Number 1 Region: 3-176
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.39e-37
Family GHMP Kinase, N-terminal domain 0.00072
Further Details:      
 
Domain Number 2 Region: 192-326
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.13e-26
Family Mevalonate kinase 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|474933655|ref|YP_007687237.1|
Sequence length 342
Comment putative kinase (galactokinase and mevalonate kinase -like protein) [Thermoplasmatales archaeon BRNA1]
Sequence
MTEIVRARAPLRIGLAGGGTDVNPYASERGGYVFNTTINKYAFSTLKPRRDKNMSVTSEY
YGRYKAPLDGGPLPLDGNMDLIKAVANYFFDSRGFEPQGFDLSIRSDVPAGSGLGGSSTM
IVSMIEALANWLDVDMSKVEMAQLAYHLEREVIGLKGGMQDQYAAVFGGFNSLKIDKNGV
NVLPAHLSQDIVNELQCRSVMCFTGMTHDSAAIIETQVKTYREGKNDDALDKAKDIAIRF
RSSLRHGDIDDCGRLLGESWEYKKRFSNKISNPEIDDLYNAAVKAGAIGGKVSGAGGGGF
MYFICGYDKKPAVTKALAAAGATISNFMFEPNGVTSWRSNYD
Download sequence
Identical sequences M4YL43
WP_015491594.1.41762 gi|474933655|ref|YP_007687237.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]