SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474933866|ref|YP_007687448.1| from Thermoplasmatales archaeon BRNA1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|474933866|ref|YP_007687448.1|
Domain Number - Region: 53-97
Classification Level Classification E-value
Superfamily L domain-like 0.00103
Family Ngr ectodomain-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|474933866|ref|YP_007687448.1|
Sequence length 149
Comment hypothetical protein TALC_00278 [Thermoplasmatales archaeon BRNA1]
Sequence
MHPSFREVLERQDGIVAEGGMLFSVTEGGASLMMYTGNSDTVCVPDSVSGAPVVSIDESA
FSGNLALRCVSIPGSVRDIGDSAFEGCSCLQRIYIQGIPSFGNRCLSLGTYDRQVICEVF
APEEVLQMLSDPRSWAYDPDGTFFVPKRR
Download sequence
Identical sequences M4YN96
gi|474933866|ref|YP_007687448.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]