SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474933913|ref|YP_007687495.1| from Thermoplasmatales archaeon BRNA1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474933913|ref|YP_007687495.1|
Domain Number 1 Region: 3-209
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.14e-52
Family Ribonuclease PH domain 1-like 0.00000386
Further Details:      
 
Domain Number 2 Region: 181-259
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.11e-18
Family Ribonuclease PH domain 2-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|474933913|ref|YP_007687495.1|
Sequence length 260
Comment RNase PH-related exoribonuclease [Thermoplasmatales archaeon BRNA1]
Sequence
MSTPIVSQIRRDHLLNLLAEGRREDGRQLDEFRSIKVETGLIESADGSARVELGDTVVMA
GVKIVPGVPYPDAPGDGTLTTGMELLPMAHPMFEPGPPDENAIEMARVVDRGIRESGMID
VKKLCIKEGESIWMVFLDLYAINHDGNLFDAATIASVCALRTATIPWKQYFPDMEKDDEP
LPVTCLPISVTEHKIGNDLIVDPNFDEEAIATARLTVTTDENGNYRAMQKGGRGSITRGD
LSLCLDRAVEIGNKIRSIIG
Download sequence
Identical sequences M4YJW2
gi|474933913|ref|YP_007687495.1| WP_015491852.1.41762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]