SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474934052|ref|YP_007687634.1| from Thermoplasmatales archaeon BRNA1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474934052|ref|YP_007687634.1|
Domain Number 1 Region: 271-551
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 7.06e-127
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.00000000802
Further Details:      
 
Domain Number 2 Region: 5-270
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 1.53e-118
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.0000000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|474934052|ref|YP_007687634.1|
Sequence length 552
Comment methyl-coenzyme M reductase, alpha subunit [Thermoplasmatales archaeon BRNA1]
Sequence
MAQKEKLFLEACKKKFKEEPTSMETKYYCYGGWKQSKSKVEFQKEAMEIAKKRGFPMMNE
DVGVPLGQRSWMPYQLSHTDIFVEPDDLHCINNPAIQQAWDDIRRTVLVGLDSPHQTIEK
RLGKEVTPETINAYLEAVNHTIPGGAIVQEHMAECNPALVYDSYVKVFSGNDELIDEIDP
RFVIDINKNFPKDQAEKLKKAMGKTVMQAVRVPTMVGRVMDGATVSRHAAMQISMSFISS
YKLAAGEAAIADFAYSAKHLSINMGTMMPARRARGPNEPGGITFGYLGDMVQSDRVYPDD
PARSVLETVALGAIIYDQIYLGGYMSGGVGFTQYATAAYTDNILEDYVYHAVDIIKDKYG
GFCGVKADDYKKQLQLGDEISSYALEMYERYPAVMETHFGGSQRATVTAASTGIAGAMAT
GVADNGLNLWYQSMLQHKERTGRLGFYGFDLQDQCGSSNSYSYRSDEGLPMELRGPNYPN
YAMNVGHLSGYAGIPKAAHVARGDAFVANPFVKVAFSDKSLIFDFANITKEIGRGGLREF
QPAGERTAVIKG
Download sequence
Identical sequences M4YK22
WP_015491991.1.41762 gi|474934052|ref|YP_007687634.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]