SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474934466|ref|YP_007688048.1| from Thermoplasmatales archaeon BRNA1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474934466|ref|YP_007688048.1|
Domain Number 1 Region: 195-391
Classification Level Classification E-value
Superfamily "Helical backbone" metal receptor 4.71e-19
Family TM0189-like 0.037
Further Details:      
 
Domain Number 2 Region: 3-65
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000288
Family Type I dockerin domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|474934466|ref|YP_007688048.1|
Sequence length 407
Comment hypothetical protein TALC_00893 [Thermoplasmatales archaeon BRNA1]
Sequence
MRLVVYGNANNDNYLNDKDVDLIKSIAKDGNWDKETNPFADANNDGKVDSSDVDAVNGFL
EGKTSIMYYRDWNNKVSYVHYPVTGKIGVSYDVCLDAAILGGWYGQVKYMNINQSEISEI
DESYYPGVHSFISTGKNGHDFDEVYSHEDLALCCGDNYNFSDEFISKMLGAHNNGGTKDV
LLLPFARCVNGMDMSTTIITVSVMTMHQADCKKYIEYLEGIDKSVHSKLDKMGNNLSEVI
FYRVNGNDNFTLRVPNSTGFHHSNVYMIKSLGFKSAAGESKNGGVNCGIDEIIHYDPDVI
FVINTGWVYADLTDEQFKSKVKEMFGYLEQTRAYKQGNVFYIGYELIGSAPAYAVLPLLA
SFVWPDQFDEDDGWKELQDFYSKYLNRNIDVKNSHIAPLKMSDLGLA
Download sequence
Identical sequences M4YPZ3
WP_015492405.1.41762 gi|474934466|ref|YP_007688048.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]