SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474934702|ref|YP_007688284.1| from Thermoplasmatales archaeon BRNA1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|474934702|ref|YP_007688284.1|
Domain Number - Region: 46-105
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000275
Family Type I dockerin domain 0.0064
Further Details:      
 
Domain Number - Region: 134-425
Classification Level Classification E-value
Superfamily "Helical backbone" metal receptor 0.00314
Family TM0189-like 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|474934702|ref|YP_007688284.1|
Sequence length 464
Comment hypothetical protein TALC_01135 [Thermoplasmatales archaeon BRNA1]
Sequence
MIYMDPSQTKIIAIVCVAVLAVGAGAAVFLYMGSDGSDPDYGAALPVYGNADLDADIDSD
DLDVIQKIIDQKEGYTLAKYGLADANRDGKVTADDKTLVQNIIDKKEVTIFHNSYANDGG
DKVTISVVSSKWPATNVMTTYNSTEFIFKVIGASANVVAGTDAKSTGQDLALYWDIYANA
SALATTDWGMNIDLDNLSTVMEAKKTRTLFASGYSAYDATNVDGIEALGCDVIRLCESVP
LLEPTVASILLAGFFVDKLDNAKDVAELYTKVYNKTMTLAGKIADADKVKFMCGLGGENN
QHTVKCVKAGGAFALTGATDAVIDMYGSYEVGDWIYKYKVDCFLEPVWSNANNGHFFDKT
LNKANILKIFGDDPDIDGWGTHGLNIENMQVYKDGHVYVVYGDLPMSFDILLRGYTMYPD
VYKSLYNDSMEELLEHLGKNKDGKEFSSLGLKFVYSIEEIKALP
Download sequence
Identical sequences M4YLR3
gi|474934702|ref|YP_007688284.1| WP_015492641.1.41762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]