SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474934717|ref|YP_007688299.1| from Thermoplasmatales archaeon BRNA1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474934717|ref|YP_007688299.1|
Domain Number 1 Region: 5-230
Classification Level Classification E-value
Superfamily Aquaporin-like 3.66e-53
Family Aquaporin-like 0.0000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|474934717|ref|YP_007688299.1|
Sequence length 235
Comment Glycerol uptake facilitator and related permeases (Major Intrinsic Protein Family) [Thermoplasmatales archaeon BRNA1]
Sequence
MDNAFRSYFAELIGTMVLVLFGCGAAVFLGGVVGGGALAIALAFGLTVVVMSVTVGNISG
AHLNPAVSLGMFLDKRIDLKTFVMYFIFQLVGAIIGAALLAVFAMGAFDCGFGDLGNLAM
ATNDAEGVGVAYAMIIEIVLTMIFVLIALAATAKNGMDKFAGLYIGLGLTMVHLVGIPLT
GCSVNPARSLGASILHVAEGADFVASEFYVFLIAPLIGAAIAWAIWKFVLDDDAE
Download sequence
Identical sequences M4YLS6
gi|474934717|ref|YP_007688299.1| WP_015492656.1.41762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]