SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474934742|ref|YP_007688324.1| from Thermoplasmatales archaeon BRNA1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474934742|ref|YP_007688324.1|
Domain Number 1 Region: 133-421
Classification Level Classification E-value
Superfamily "Helical backbone" metal receptor 6.67e-20
Family TM0189-like 0.03
Further Details:      
 
Weak hits

Sequence:  gi|474934742|ref|YP_007688324.1|
Domain Number - Region: 43-94
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00209
Family Type I dockerin domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|474934742|ref|YP_007688324.1|
Sequence length 441
Comment ABC-type Fe3+-hydroxamate transport system, periplasmic component [Thermoplasmatales archaeon BRNA1]
Sequence
MASMKIIAIVVVAAVVVAGGAAAVFMLNNDDYYSDNSDCRLQILGNADKNDYLDSKDVDK
INELIENKQYDLMADANHDDKVDAADAEFVKKLIDLKKSNTGKAAADKEKVTVYYITVDN
KVQPATYPVNKMIIVNTQRALDLCINLGITDRIVALNDYIFDQAINVDTIKYKGFSSYPS
VGDRKEPNLETITKTDADTIFAGTTGTYMKNISASAATYGEKTVLRLATWERGEFCSGAL
TLGFFTDADDNAQKYVKWNDKINEVTSDALAKVNTKATKMLNASSATWFGAQSDGVSTAL
TATGVTNIGNDIIVKTTGSGGSVTTYKENIVKANPSVIVLSYTVGYNWTQEQMDDKFNGI
VTTMKGSIGATTAITNNNVCWLNYYMPFCLITMVGAKLMFPDAMSDVNVDKYIQEYLKDY
CSNITDYTYNSAHFYRVAATA
Download sequence
Identical sequences M4YLV2
gi|474934742|ref|YP_007688324.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]