SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474934051|ref|YP_007687633.1| from Thermoplasmatales archaeon BRNA1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474934051|ref|YP_007687633.1|
Domain Number 1 Region: 8-254
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 2.12e-110
Family Methyl-coenzyme M reductase gamma chain 0.0000000264
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|474934051|ref|YP_007687633.1|
Sequence length 259
Comment methyl-coenzyme M reductase, gamma subunit [Thermoplasmatales archaeon BRNA1]
Sequence
MAVKYKRQFYPGQSIPAQNRRRYLDPKVKLKKLRDVPMDDVVRLMGHRAPGEAYKSIHPP
IEEGKEPKCPIRELVVPIEGAKHGDRVRYIQFTDSVYFAPISPYQRAWMYMSRWRGVDTG
TLSGRQIIEVRERDLEVYAKELIDDETFDPALTGIRGSTVHGHACRLDENGLMFDGWQRY
VWDAKKKEVVYKKDQVALPLDKDIYVGKPASMENLKKRTTIFRADGVDMRDDKEVTDFYI
RVHWLRTLGGYRPFDVKGE
Download sequence
Identical sequences M4YNV7
gi|474934051|ref|YP_007687633.1| WP_015491990.1.41762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]