SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|152998864|ref|YP_001364545.1| from Shewanella baltica OS185

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152998864|ref|YP_001364545.1|
Domain Number 1 Region: 33-104
Classification Level Classification E-value
Superfamily Coronavirus S2 glycoprotein 0.0000837
Family Coronavirus S2 glycoprotein 0.0089
Further Details:      
 
Weak hits

Sequence:  gi|152998864|ref|YP_001364545.1|
Domain Number - Region: 49-210
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0471
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|152998864|ref|YP_001364545.1|
Sequence length 217
Comment hypothetical protein Shew185_0312 [Shewanella baltica OS185]
Sequence
MKRLITSGLIAASLLLSGCQSAYYGAMEKVGYHKRDIMVDRVKDAKESQEDAQKEFSSAL
EEMQALLNHDGGNLEKAYNKAKDEYESAQSAADNVSNRIKKVEDVAEALFDEWQDEIGEI
SKASLRRNSEAKLKETRRAYEQLIKSMHRAESKMPPILTAMKDNMLYLKHNLNAQAIGAI
KGEFASLQTDISGLIKEMNKSINESNKFIESLEKSKS
Download sequence
Identical sequences A0A161UST2 A3CZD3 B8E4B3 G0ASX0
325240.Sbal_0313 402882.Shew185_0312 407976.Sbal223_0318 WP_006079785.1.19221 WP_006079785.1.24904 WP_006079785.1.35668 WP_006079785.1.35710 WP_006079785.1.74325 WP_006079785.1.8014 WP_006079785.1.85636 WP_006079785.1.86146 gi|386339341|ref|YP_006035707.1| gi|152998864|ref|YP_001364545.1| gi|126172566|ref|YP_001048715.1| gi|217971526|ref|YP_002356277.1| gi|386326347|ref|YP_006022464.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]