SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|111219675|ref|YP_710469.1| from Frankia alni ACN14a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111219675|ref|YP_710469.1|
Domain Number 1 Region: 111-248
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 2.01e-17
Family GntR ligand-binding domain-like 0.009
Further Details:      
 
Domain Number 2 Region: 425-564
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.000000000000196
Family GntR ligand-binding domain-like 0.013
Further Details:      
 
Domain Number 3 Region: 334-407
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000247
Family GntR-like transcriptional regulators 0.04
Further Details:      
 
Domain Number 4 Region: 20-92
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000297
Family GntR-like transcriptional regulators 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|111219675|ref|YP_710469.1|
Sequence length 567
Comment GntR family transcriptional regulator [Frankia alni ACN14a]
Sequence
MESARGPAISVRHPPRGDARGKLAAQVAWRIEDDIVRAGWPVGTVIGSEPTLIERYKVSR
AVFREAVRIVEHHQVATMRRGPSGGLIVRAPDEVAVTTALGVYLEYVGVTIESILRARFI
IESLAASLAPARITEDGIRTLREIIARRETADPTEFGSHHQLHHAIAAATGNPVLVLFVD
VLNSLTFRYAAHQYATTRSSASPARRAQVAEEVHRNHAAIAEAVIGGDAARAQHLAAVHL
EAMYEWMTTPIAADGPDRAGSEGTATNRDTATNRDTAANGRVATQGGTGAPEGTATGEGG
AAGEGGASVRAGGRRIRPGEPGLGSGPGPGGTMPAGKLAETVAGRIRDDVARDGIPVGVV
IGSESDLLARYGVSRAVLREAVRLLEYHSVAQMRRGPGGGLVVTEPDPAATVEATALYLE
YSQASVDDLRIVRDALELSCVDVLIERRGPELTARLEELLVADACEVPGGPADAGHHLHM
ELARLTGNEALASFVRVLTAIWRRHVDGSRPAPAIGDGEAAAGGCGQAVREARTAHRAII
DAIIAGDRGLARHRMRRHLEAVSDWSR
Download sequence
Identical sequences Q0RU87
326424.FRAAL0177 gi|111219675|ref|YP_710469.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]