SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|111220012|ref|YP_710806.1| from Frankia alni ACN14a

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|111220012|ref|YP_710806.1|
Domain Number - Region: 8-33
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0196
Family NfeD domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|111220012|ref|YP_710806.1|
Sequence length 51
Comment hypothetical protein FRAAL0522 [Frankia alni ACN14a]
Sequence
MRVRGGIETFLALSDTPLPKGASVLVIGTRGPRTVEVVPWLDPAAVFGGDL
Download sequence
Identical sequences Q0RTA4
326424.FRAAL0522 gi|111220012|ref|YP_710806.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]