SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|111221414|ref|YP_712208.1| from Frankia alni ACN14a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111221414|ref|YP_712208.1|
Domain Number 1 Region: 17-271
Classification Level Classification E-value
Superfamily Cgl1923-like 2.35e-86
Family Cgl1923-like 0.00000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|111221414|ref|YP_712208.1|
Sequence length 312
Comment hypothetical protein FRAAL1976 [Frankia alni ACN14a]
Sequence
MLDPQELYSLTEDASDDPIDAHRPIMLEALTGVVDAGNAVSLAGEHLLTALDHRIVATFD
VDQLLDYRSRRPTMIFSEDHWESYTDPVLALYQLRDESDTPFLLLTGPEPDLQWKRFTAA
VRGLVARLGVRLTVGLNAVPMAVPHTRPATITAHGSSKELVVGYEPWLRRLQVPGSAGHL
LEYELGRDGRDAMGFAVHVPHYLAQTTYPAATEVLLTSVSKATGLMLPLDGLRSAAVAVQ
DEVNSQIAQGGEAAALVHALEEQYDAYQRGRRGPSLPTIDAEQKLPTADELGEALERFLA
EQSEPGGPNPLS
Download sequence
Identical sequences A0A0D8BMT8 A0A0N8WI84 Q0RPA7
326424.FRAAL1976 WP_011603149.1.38265 WP_011603149.1.54056 WP_011603149.1.98738 gi|111221414|ref|YP_712208.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]