SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|111221553|ref|YP_712347.1| from Frankia alni ACN14a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111221553|ref|YP_712347.1|
Domain Number 1 Region: 79-141
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000523
Family NfeD domain-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|111221553|ref|YP_712347.1|
Sequence length 144
Comment integral membrane protein [Frankia alni ACN14a]
Sequence
MADWAIWVVVAGALLVGELLTLDLTLVMFSLAALVGAAVAVLGVDVAWQIVGFVVAAGGF
GLGLRPVARRHLQRGPELRTGTEALLGEQALVVEQVSGDGGRVKIKGEVWSARSYPTTTV
LEVGSQAHVLRIDGATAIVHRFEI
Download sequence
Identical sequences Q0RNW8
326424.FRAAL2119 gi|111221553|ref|YP_712347.1| WP_011603284.1.38265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]