SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|111221694|ref|YP_712488.1| from Frankia alni ACN14a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111221694|ref|YP_712488.1|
Domain Number 1 Region: 111-240
Classification Level Classification E-value
Superfamily Sortase 0.0000000000118
Family Sortase 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|111221694|ref|YP_712488.1|
Sequence length 385
Comment hypothetical protein FRAAL2262 [Frankia alni ACN14a]
Sequence
MRRVDRAGGTVEGETNDGHRKPASGPVPVAAATRRPLLWRGLLLVGLVLIVGSGFRLAEP
ALDAVRGGSGTDAAADLPDIPPPPPPPPAASAGPAIGLPPALVEQPVVVINDPVRLRIRR
MGIDAPITHLGLSPDGSVAVPKAWGDVGWFDRGPAPGGIGPAVLVGHYDSTTGPAVFYRL
PQLVPGDRIEVAGRTGAAQAFIVDRKEDVSKAAFPSQRVYGPVARPELRLITCGGAFDHK
TKHYLNNVVVYAHADTFAGPAPGAPAGPAPAAPATGGKPAAPPSSAPLGSAPLGSVPPGA
AIGPTRTAAVAPAGGGTGPSAGAAGALTHAPAVPPARAARPPAGAAAVPPAGAAAVPAST
AHAGTLVLPGASSGGGSPAAGGPFR
Download sequence
Identical sequences Q0RNH7
326424.FRAAL2262 WP_011603429.1.24492 WP_011603429.1.38265 gi|111221694|ref|YP_712488.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]