SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|111222130|ref|YP_712924.1| from Frankia alni ACN14a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111222130|ref|YP_712924.1|
Domain Number 1 Region: 25-108
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000499
Family LysR-like transcriptional regulators 0.037
Further Details:      
 
Weak hits

Sequence:  gi|111222130|ref|YP_712924.1|
Domain Number - Region: 130-273
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.00126
Family Phosphate binding protein-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|111222130|ref|YP_712924.1|
Sequence length 344
Comment hypothetical protein FRAAL2708 [Frankia alni ACN14a]
Sequence
MQLSVSAAQEIADALGCPAPLLDVTFDQLRTLLAVCQSGSPLQAARLLGREHSSVRKQVD
TLNRIFSAICGEPLAVKQGRGQDYLFTPTGETVAGIARAMFTEWTTGILDRRRRLGSTIT
VATTEFTIDFVAQVWPAVAEEFTRREIDLNIVHVRSRELWAQLDAKNVDLVAGSIPAGPG
PDPIPDAYEVLEWHREDLALLTNLPLHDLPVDAVDQQRLPTIPLLAPSAGLIAEFLRRWY
GPDYASQLRIVAEADNIYYGLALLRSPLVRGALLATHATAQAALDGRLPGGPGLRLVRLT
DDYQPPLQVLAGIFGRKGERQRYDAHHPLNLLWNALTAHVTARQ
Download sequence
Identical sequences Q0RM98
gi|111222130|ref|YP_712924.1| WP_011603862.1.38265 326424.FRAAL2708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]