SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|111222879|ref|YP_713673.1| from Frankia alni ACN14a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111222879|ref|YP_713673.1|
Domain Number 1 Region: 89-224
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.44e-18
Family GntR ligand-binding domain-like 0.021
Further Details:      
 
Domain Number 2 Region: 2-70
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.09e-17
Family GntR-like transcriptional regulators 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|111222879|ref|YP_713673.1|
Sequence length 255
Comment GntR family transcriptional regulator [Frankia alni ACN14a]
Sequence
MAELVASDLRQAIVRNTLAEGQALPPEAVLMGQYGVSRPTLREALRILEAESLITVRRGA
GGGARVQSPNPAVAARYAGLVLEHRATTIADVWDARLLLEPPTAAALARRRTRADLRALR
ALLAEHDAATERVQGVRLHNEFHTLVVRLAGNETLALLITLLGEIINRTTWTRVEADLGT
PELARAERGTVRVHAMLVDLVEAGDATGAQDLWRRHLAAGARYLGQGGRDEATLDLLGRP
GEPGAPIDSDGWLAG
Download sequence
Identical sequences Q0RK50
WP_011604609.1.38265 gi|111222879|ref|YP_713673.1| 326424.FRAAL3465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]