SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|111223171|ref|YP_713965.1| from Frankia alni ACN14a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111223171|ref|YP_713965.1|
Domain Number 1 Region: 2-61
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.31e-16
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.0034
Further Details:      
 
Domain Number 2 Region: 62-144
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 0.000000000000161
Family Lrp/AsnC-like transcriptional regulator C-terminal domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|111223171|ref|YP_713965.1|
Sequence length 147
Comment AsnC family transcriptional regulator [Frankia alni ACN14a]
Sequence
MLEDLDRRIVQMLCRDGRMSFTDLGRATGLSVSAVHQRVRRLEQRGVITSYTALVDPSQV
GLPLTAFVSITPIDPSQPDDAADRLAHIVEIEACHSVAGEESYLLKVRVASPGDLEVLLQ
RIRAAANVSTRTMVVLSTPYEGRPPAL
Download sequence
Identical sequences I9KDR8 Q0RJA8
326424.FRAAL3761 WP_009738598.1.23052 WP_009738598.1.38265 gi|111223171|ref|YP_713965.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]