SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|111223387|ref|YP_714181.1| from Frankia alni ACN14a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111223387|ref|YP_714181.1|
Domain Number 1 Region: 84-218
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.00000000000000968
Family GntR ligand-binding domain-like 0.014
Further Details:      
 
Domain Number 2 Region: 2-76
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000322
Family GntR-like transcriptional regulators 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|111223387|ref|YP_714181.1|
Sequence length 254
Comment GntR family transcriptional regulator [Frankia alni ACN14a]
Sequence
MAERDDGVAPSVRAYESLRAAVMHGQFRPGQALRPQELAVERGVSLAVVRECLLRLVGEG
LAERLPNRGFVVPEAGDVRWQVIAEARAAVEPTMLRMSISRGDLEWETRVRAAHHRLAGT
PPFEHDGDAHFSDAWAAAHHGFHRALLDACGNDVLLDTFERLWTASELSRRWSAAGNPAR
NYLAEHRRLERLALSRQSEAAADALVTHIAGTAAALTEATTSTETTTTTDTTTDRATTTT
TDTATPAEHTRKDG
Download sequence
Identical sequences Q0RIP2
gi|111223387|ref|YP_714181.1| WP_011605115.1.24492 WP_011605115.1.38265 326424.FRAAL3984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]