SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|111224265|ref|YP_715059.1| from Frankia alni ACN14a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111224265|ref|YP_715059.1|
Domain Number 1 Region: 90-220
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.000000000123
Family GntR ligand-binding domain-like 0.022
Further Details:      
 
Domain Number 2 Region: 3-61
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000083
Family GntR-like transcriptional regulators 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|111224265|ref|YP_715059.1|
Sequence length 228
Comment GntR family transcriptional regulator [Frankia alni ACN14a]
Sequence
MSTASAVAHVLREEILSRQDGDLYLGQEDELLARFGVSRPSLRQAVRLLQAEGILTVRRG
HHGGLYGQRPDAAGVAHVASVFLRTRRASLADISATYTLITTECARLAALNPDGVERRRL
LTFVEQAVGGNQRDHARARVQWGILLAELARSPTLQLFEDVLGSLSRYPTSRPLLLDPDS
IALACEQWRQVAEAVRDGDADTAAALSRAHGDARVRYIRDLPEDLLGW
Download sequence
Identical sequences Q0RG72
326424.FRAAL4876 gi|111224265|ref|YP_715059.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]