SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|111224304|ref|YP_715098.1| from Frankia alni ACN14a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111224304|ref|YP_715098.1|
Domain Number 1 Region: 9-79
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.88e-17
Family GntR-like transcriptional regulators 0.0068
Further Details:      
 
Domain Number 2 Region: 100-243
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.00000000000549
Family GntR ligand-binding domain-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|111224304|ref|YP_715098.1|
Sequence length 263
Comment GntR family transcriptional regulator [Frankia alni ACN14a]
Sequence
MGRRVRVPKTAELVASQLRRRIIRGELTEGDALPPEPTLMAQFGVSRPTLREAFRVLEAE
ALISVRRGAHGGARVHLPSPAVAARYAGLVLEHRGATLGDVHQASAVIEPPCAALLAERR
SPADVSALRAILAEADEVAEDPAALAAAQASFHLAVVELTGNKSLSVVTGMLQHLVELTN
SQHGHATVGAVPDASPASTAADDRATDVRLSAGATRQIHAALVDLVEIGDAAGADRHWRQ
HLAAPDHAIPGGPADRCVLDLLG
Download sequence
Identical sequences Q0RG33
gi|111224304|ref|YP_715098.1| 326424.FRAAL4915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]