SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Tulca1|114291|CE27046_10133 from Tulasnella calospora AL13/4D v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Tulca1|114291|CE27046_10133
Domain Number - Region: 41-91
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000412
Family Rhamnogalacturonase B, RhgB, middle domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Tulca1|114291|CE27046_10133
Sequence length 272
Sequence
MRGLTTFLLLLLVSVVSAVDVHGSVEFNKVCLDIKALKPTRVTLDWGTYSAHVWRDGRFV
LRNVEPGSYVLNVLARDHVFDQLRVDVIPKEQPEAKTDTPQTATGITSAAPSVTPGPLAP
LASTISDPNFHIRIYPLPLGTPHYPTPSLPQLPYPIVLKPRIAKVYVEPKKDFNPIDMFR
SNPIMLVMLGSVAMMFLMPKIISNMDPQDREEFLATQSKMMAMPAQLSQGISGLSEGRSS
ASSSQQQSRTGATSSSNSQATSTPKKKKGAKR
Download sequence
Identical sequences A0A0C3Q2Z4
jgi|Tulca1|114291|CE27046_10133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]