SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Tulca1|190377|CE103132_151 from Tulasnella calospora AL13/4D v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Tulca1|190377|CE103132_151
Domain Number - Region: 2-49
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00078
Family Protein kinases, catalytic subunit 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Tulca1|190377|CE103132_151
Sequence length 125
Sequence
MTTAADVYAFGGLVLAVISGKSPLSQKRNHAARTFAVCVHEITRPADHPLLPEPDYLRSL
HNESRSTDPEACQSMVLTLTQARFRLVLRAKRVFRSPFPLPCCLDLAREREGAPQCPRQL
VSVSQ
Download sequence
Identical sequences A0A0C3QK03
jgi|Tulca1|190377|CE103132_151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]