SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Tulca1|212420|MIX2826_12_11 from Tulasnella calospora AL13/4D v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Tulca1|212420|MIX2826_12_11
Domain Number 1 Region: 20-276
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 7.22e-74
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.000000164
Further Details:      
 
Domain Number 2 Region: 368-535
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.19e-53
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.000000931
Further Details:      
 
Domain Number 3 Region: 278-358
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000000019
Family Rhamnogalacturonase B, RhgB, middle domain 0.0000605
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Tulca1|212420|MIX2826_12_11
Sequence length 615
Sequence
MRYAILAAATAAIAPVAQAAFGYTSSGGYWTVDAGSDNPLVFKVSQSSCDITSLVYRSVE
YQYSSQYTHIGSGLGSVTASITTVGNYIKITCVTSTLTQYIVVGNGDSTIYLATYTTAEP
SIGELRFIARLKSDLLTTSAYPQSYSGLGTAGAVEGSDVYKDSAGYTYSKFYSSVRFIED
KAHWVGTSDASVHVTMCMPGNAYESSSGGPFHRDINTDKTSTGAGAHNLYFYMNSGHAQT
ESFRQGLHGPYALAFSRSGIPDGKTELPFFADLGISGYVANSGRGTIKGTASGVSSSYTP
VVHWYNSAAQYWSYVSGSSFTSPLMKPGTYTMVLYKGELAVGSQTVSVSAGGTTTSNIAS
SNDPTSTTPTWIIGDFDGKPTGFLNADLQERMHPSDPRMHSWSAVTYTIGSSSTSSFPMA
QIKVVNNPTTIKFTLSSSQTGAATLRIGSTLAFAGGRPQVTVNSWLGPAPAAPVDLNSRG
FTRGTYRGNNVIYEVSIPSGVLVSGTNYVYINVISGSSGDTFLSPNFIYDAVALWTAGGT
AATTTTTKTSTTTTTSKAATTTTTTSSVRHFSSCAKPIAHYAPTFSQVVPLRRTANAVEV
AGVSISIYHLLLLLS
Download sequence
Identical sequences A0A0C3LT20
jgi|Tulca1|212420|MIX2826_12_11

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]