SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Tulca1|244099|fgenesh1_kg.102_#_5_#_Locus8958v1rpkm6.01 from Tulasnella calospora AL13/4D v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Tulca1|244099|fgenesh1_kg.102_#_5_#_Locus8958v1rpkm6.01
Domain Number 1 Region: 9-146
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000000000117
Family APC10-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Tulca1|244099|fgenesh1_kg.102_#_5_#_Locus8958v1rpkm6.01
Sequence length 147
Sequence
MAGSLIDPDTKIKVSSTLDRSVGKRYLTDRSPETCWTSSQGLPQTIQMAFGQPVIPTTLS
ITFQGGFVGTKCSVYSQPNDSTLSEWVLLRQVFPEDVNRVQSFQLRERIEENESAALAVT
QLKLVFEESSDFFGRITIYDLDIIGMK
Download sequence
Identical sequences A0A0C3KVC5
jgi|Tulca1|244099|fgenesh1_kg.102_#_5_#_Locus8958v1rpkm6.01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]