SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Tulca1|29654|gm1.13209_g from Tulasnella calospora AL13/4D v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Tulca1|29654|gm1.13209_g
Domain Number 1 Region: 3-104
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000474
Family Tetratricopeptide repeat (TPR) 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Tulca1|29654|gm1.13209_g
Sequence length 123
Sequence
MRNEYSKAEESYIQARDIYSQIGYQLGVAQSFEGIGRVHAARAEYSRAEESYSEAGRIYH
RIRDMRGSANILWYRGWLHRNQGQYGEAERLVVEASAIYGRLGVEQYVEDCDQFLDDIRP
LID
Download sequence
Identical sequences A0A0C3KGT8
jgi|Tulca1|29654|gm1.13209_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]