SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Tulca1|35178|gm1.18733_g from Tulasnella calospora AL13/4D v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Tulca1|35178|gm1.18733_g
Domain Number - Region: 3-61
Classification Level Classification E-value
Superfamily TPR-like 0.00125
Family Transcription factor MalT domain III 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Tulca1|35178|gm1.18733_g
Sequence length 82
Sequence
EESFTQALTLYKSIAKSLGQANSLVGLSEVLICQARYPEAKPLLDDLAQLSNQIDYEWGR
DRSKKLLAEVLEAEKLCTEPSP
Download sequence
Identical sequences A0A0C3L0J3
jgi|Tulca1|35178|gm1.18733_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]