SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Tulca1|138137|CE50892_1751 from Tulasnella calospora AL13/4D v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Tulca1|138137|CE50892_1751
Domain Number 1 Region: 718-799
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000434
Family Ras-binding domain, RBD 0.013
Further Details:      
 
Domain Number 2 Region: 810-921
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000697
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Tulca1|138137|CE50892_1751
Sequence length 1003
Sequence
MYAPSHPSPIAEEDEDGPGIEYDDEFDEEEDVFEYEECSAPPSSPDYSFLDDLEEEEEEE
EDALDETPSSGAGGEKPQLSREILTASVAIAVSLVQESHGDMLRPPSQRPNTLSASPAPS
SCLLPSPNFLPLPELSPRGSGSISSGDAEGSVLSGNGGMDTYTSYWRNESQQASSSSTAA
RLPCSAHRHMSWDLTIQSPPHVTTITCPSFSTHLDSSFLQLLHQTGRRALSFSLGDVNPY
NTIKKMATSSRAQSYGAYPRQHQQQDFFAGHHSSHGANGAGRDVGRGDRDLFGRKSLDAG
TAGDDRRRRVPYAPNSSALDDDDDDDEDEDDMARYGAPERPNARRASESLRVPRQPSSRP
SSSRSSASKLPPVPPLPSQYQPAASPRPQASPIMSPTHSRNHSGSHHPPPSAFHAPAPHP
ATNPPTPSRPSFSRSASRNKTSNESTSSDDDVPLGKRIPTALTAQKSIRKKARDDRDRNA
VRGRAGGLGLSNAPAPDELASKLLNVQQTGLERGRSMASSANVSRSASRHHTHGHPSPNM
RRLEDQLQSYQIAGEPKSLQHARSVRRSEDEYSASRPNPRPRLRSLGPSSERPAVTDFAP
PPMPSSRSRPVSPDRLHPPQGSTPTSRESSGRSLSHAPSQSRTRSRANTVSANDRNHHGD
DHLRRARTVRDPHGQDGKSPLLAPGSQPGARLPSPSDHFAAPPLPASPIKQTFADTEQLR
IFIGDLQRFVNVEITSMTTADDVIEMVSSQGELDGRDWMLWELANEFGMERPIRDYERLA
DVFTSWNKECRLNALMLKQTPLAVSLSRKYLPNSSPTFSGWVQWEVKKGKWQKRWLELRE
HSLFLCKKDNGKDAALLCSLSKFDAYVVKRVTKAPKPFVFAAKSCDSIAMFENPADCVHS
FCCDSDDGKDWLEKILLARSYVLYQERNVLFRTQRAASAGNSTGASIQRSNTRRNPHQPL
IPDVAPSLPAMPFQQSSSHQSRTAQGGNVFAEGSLLARPTPQF
Download sequence
Identical sequences A0A0C3PYG6
jgi|Tulca1|138137|CE50892_1751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]