SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Tulca1|18488|gm1.2043_g from Tulasnella calospora AL13/4D v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Tulca1|18488|gm1.2043_g
Domain Number 1 Region: 26-148
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000364
Family delta-Endotoxin, C-terminal domain 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Tulca1|18488|gm1.2043_g
Sequence length 151
Sequence
MNTNYVNWVIDPNTGTWGGGPSENSYEGESATLSNGAKSVSCTGCSGTKAAGYVGGSSNG
IIKFNSVSSNASTKTTIRIKHENGDTSQRFADVTVNGQTQRIAFLPTTDGNTPGSSTLHV
NLNSGSSNTVQFVGVSGGWVSDIDRIMVPVS
Download sequence
Identical sequences A0A0C3QTF0
jgi|Tulca1|18488|gm1.2043_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]