SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Tulca1|18493|gm1.2048_g from Tulasnella calospora AL13/4D v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Tulca1|18493|gm1.2048_g
Domain Number 1 Region: 78-350
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.13e-42
Family Protein kinases, catalytic subunit 0.00072
Further Details:      
 
Domain Number 2 Region: 368-440
Classification Level Classification E-value
Superfamily TPR-like 0.00000000035
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Tulca1|18493|gm1.2048_g
Sequence length 441
Sequence
MAPSDPWKSSSKHDPDSLKEGFDALQVRDMETPQSCTGMSVAGVKKAEKFAQKLLATLSG
RRLSISEIKVIGNSPRDGGGYADVLVATLLRKSCNTGEPKKIAVKKLRFVLSDDMTEEKV
FRSFVNELLLLDKMSHPNIVEILSFVEDIEKRIAWLVFLWEDNGNLRDFLRSGKWEIPER
GDTSQIQDVTLRLEYLHTRQPPICHGDLKSLNILVNSSNRAIITDFGSARITNSQQSRLS
VTASNGTLTLTGLTFSFRWAPPEVLNGEQVDLASDMGAGLDRLGAITDCYPFEELDGEFQ
VTMRIVQGQLPLIYGHDQLSRIHLLYSVMERCWNPDPKQRPSSTECRKIIEWVPSAIPVK
QTSERSKIRSATLLLQLGEINRLQNRYEEASNCYMEGLTIAQSTGDWSTLARLLVQLAAN
HQADTHYVEAKSCYTQALSIY
Download sequence
Identical sequences A0A0C3QV44
jgi|Tulca1|18493|gm1.2048_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]