SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Tulca1|29061|gm1.12616_g from Tulasnella calospora AL13/4D v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Tulca1|29061|gm1.12616_g
Domain Number 1 Region: 86-241,269-375
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.64e-50
Family Protein kinases, catalytic subunit 0.00036
Further Details:      
 
Domain Number 2 Region: 387-498
Classification Level Classification E-value
Superfamily TPR-like 5.48e-16
Family Tetratricopeptide repeat (TPR) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Tulca1|29061|gm1.12616_g
Sequence length 509
Sequence
MRRFISKLAKRLQGSRFWQLFSRSRAALVGQTAGGARDAGAQQGASPDAAVETIPGKLSA
RERLDHLSGFRLSWDEISFPSSTSHRGGKAKVVQATVRREAGNEETVAVKKLYYHKDMEI
RKFSNEFVHEVELLAGLSHENIVRLIGFAEQLEQGEAWIVLSWHPNGNVREFLVTGELEI
PERISLIKDTFGGLMYLHSRNPPICHGDLKSLNILVSSSYRAIITDFGSARVRDELAERV
VPEDRGPATSQSLTGEEAKIRVGATGNQLTLTGPAWSLRWAPPEVVNGAITSLPGDMWSA
GWVCWEIMTNEFPFPKLNLERAIALTVIRGKVPSTHDDAQLSQITALCSLMTDCWKFDPI
DRPGVAQCQNEVAWMPSTPPSGVKTPSIELLLQMGELHLSHGRQEEAASLFQQALAVGGS
AGGSEGIAKALFALGRTYYLQTKCSESEESFVQAQQIFTRIGDDQGRAAALQGLGELYRL
QTRYSEAEESFVQAQQIFTRIGNDQGLAD
Download sequence
Identical sequences jgi|Tulca1|29061|gm1.12616_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]