SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Tulca1|31323|gm1.14878_g from Tulasnella calospora AL13/4D v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Tulca1|31323|gm1.14878_g
Domain Number 1 Region: 79-237,267-368
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.42e-52
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 2 Region: 395-582
Classification Level Classification E-value
Superfamily TPR-like 9.67e-27
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Tulca1|31323|gm1.14878_g
Sequence length 587
Sequence
MLRFAPKSRPQTPVSHLRAASGDQSPGNNHDGIEQGPSLTATGESIRKKLSALERLDKLS
RLRISSGEIKVVPSGPCKSGGKAEVVQAKFRKAFKFWEDKKLVAIKRLKYHKGLDEHRFS
NEFVHEVELMAELSHDNIVRLIGFVEDLKNGKAWIILSWEPNGNVSEFLATGKWEIPERI
SLIQDTFDGLKYLHTRQVPICHGDLKSLNILVSSSYRAIITDFGSARAIRESEEGGAGEG
SRPGANSDPSPEKDYSRIQVVATGNQLTLTGPAWSLRWAPPEVVNGSPQELPSDIWSAGW
VCWEVMTNKLPFPELQRVPDITLKVVQGEVPSASEDEQLSQIVRLCSLMTNCWALDPGDR
PSVSQCCDEVKWVPSLPPLGGVPSESKVVTSLLVLQMGRMHYAHARYEDATSLFQQVLRV
TAEGEGQNENAAALYWLGNVSAAQCKYAEAEASYTQAQAMYARIGDDLGRANTLQGLGGV
YHRQSKLVEAEASFTSAQVIFEALGDHQGGANTLCGLGHIYRVQSDYERAEESFTQAQEI
YTRIGDGQGLANTLQGLGNVYRVQSKLAEAEERCNQARKIYTRIGDD
Download sequence
Identical sequences A0A0C3Q6Q3
jgi|Tulca1|31323|gm1.14878_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]