SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Tulca1|32490|gm1.16045_g from Tulasnella calospora AL13/4D v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Tulca1|32490|gm1.16045_g
Domain Number 1 Region: 37-114
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.13e-21
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Tulca1|32490|gm1.16045_g
Sequence length 121
Sequence
MVLYKGELAVATQSVSVSGGGTTTSNIVSSNDPTKTTPTWIIGDFDGKPTGFRNANLIER
MHPSDTSMGSWGPVTYTVGSSSTSSFPMAQIQAVNNPTTIKFTLSSSQTGAATVSNFRTL
R
Download sequence
Identical sequences A0A0C3PSY0
jgi|Tulca1|32490|gm1.16045_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]