SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Tulca1|32991|gm1.16546_g from Tulasnella calospora AL13/4D v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Tulca1|32991|gm1.16546_g
Domain Number 1 Region: 107-372
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.6e-45
Family Protein kinases, catalytic subunit 0.00034
Further Details:      
 
Domain Number 2 Region: 446-627
Classification Level Classification E-value
Superfamily TPR-like 5e-26
Family Tetratricopeptide repeat (TPR) 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Tulca1|32991|gm1.16546_g
Sequence length 658
Sequence
MSRPIDGDTVMEDGSHHADADIRSSAGFEPSVRLRARIEKLAHWRVNPCSVAFYEGAPEF
HGGHATVSAGYMNKYMVEMRQLEKRALGKKLDRKAIHDFLRVNEKRNSLGLRVAVKRMRV
ADDTDFERVLGLAIREADFLAGTAHRNIVELEGFVEDVSESTIWLVFPWADNGNLRDFIA
SYTCEIPERISLIDDVAQGLAYLHSRDAPICHGDLKSLNVLIYNEEEIYAKITDFGSARR
LSKHDPNINTHAESQAPPVHSPSVTFNTSTKTITLTGNKYTLRWAAPELLLNDQLSLWSD
IWALGWIAYEARLPNVTSDIGVVERVVEGKLPSLANDGSLALIHELCSLMEMCWKMKPTE
RPTAESCRRTINEMPKLAPAMFEGLKIDGSQRLWRLGQIYQSRGEYGRAFNLSVKAFERT
REFGARSDIISMVRDLTQLGRGLNHYSETIALYDVIWKIYSEGSGDDFDDIANALCDLAE
LHRLRNKHDKALQPHSEGRETQEEERMAEALCKIAQQYRLADRHDKAIQLYTRAWGILTD
LGDRKGQADALWGLANAHQCRGESDKAIPLYSDAWKIRTDLGDKKGQADALWCLADAHRC
LGDYDKATPLYSRALEIRTDLDDRLASSAVAMCMMTRIAGRMLHFVEKIGNMGLKRTI
Download sequence
Identical sequences A0A0C3PRT4
jgi|Tulca1|32991|gm1.16546_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]