SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|152990798|ref|YP_001356520.1| from Nitratiruptor sp. SB155-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152990798|ref|YP_001356520.1|
Domain Number 1 Region: 327-472
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.84e-28
Family HD domain 0.038
Further Details:      
 
Domain Number 2 Region: 213-305
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000102
Family Eukaryotic type KH-domain (KH-domain type I) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|152990798|ref|YP_001356520.1|
Sequence length 522
Comment phosphodiesterase [Nitratiruptor sp. SB155-2]
Sequence
MWVEILVGSSAAIISGAAGYLLSKKIEKDKLKIYEEQARAKAKAIEHEAEKILQNAQVQV
KEAELELKRDFEKKLEELKRDYEERFNELMEKEMSLKQMFKDELKHITLEKQEIKAEREE
INRLKNEYEELKKRYQEKYQEVLEALQQQAGLTLEEAKNLILQKAEEESRLEIANIVRKY
EEEAKREAKRRANYIIAQATTRFAGEFAAERLINTVSIPSEDIKGRIIGKEGRNIKTLEM
LLGVDIIIDDTPNAIILSSFNLYRRAIATKVIELLVEDGRIQPSRIEEIYEKVKEEFDQQ
LLEEGENIVIDLGIGLIHPEIVKLIGRLKFRASYGQNALGHSLEVAHLAGIMAAEMGGDE
VMAKRAGLLHDIGKALTHEYSGSHVDLGAEICKRYKEPDVVINAIYAHHGHEEPRSIEAA
AVCAADTLSAARPGARREVLEAFLKRVQAIEEIALSKPGVKKAYAINAGREVRVIVNADL
VNDNEAVLLAKEIAKDIETGVQYPGEIKVNVIRENRAIEYAR
Download sequence
Identical sequences A6Q3V4
gi|152990798|ref|YP_001356520.1| 387092.NIS_1053 WP_012082426.1.54627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]