SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|152991321|ref|YP_001357043.1| from Nitratiruptor sp. SB155-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152991321|ref|YP_001357043.1|
Domain Number 1 Region: 66-153
Classification Level Classification E-value
Superfamily Cytochrome c 0.0000000000000645
Family monodomain cytochrome c 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|152991321|ref|YP_001357043.1|
Sequence length 154
Comment hypothetical protein NIS_1579 [Nitratiruptor sp. SB155-2]
Sequence
MKKGVVLSLIAASLMLVGCSGKKEEQKSEAVAHQTEQKAETKKAESVQQTQKSEPVKRDV
ASAVHQEQAPQTSASAQELFNKCASCHGPDGKRKALGKSGIIAGMSKDEVLKKLKEYEAG
TLNKYGMGPLMKAQVAGLSDKELEALAEYIASMK
Download sequence
Identical sequences A6Q5C7
gi|152991321|ref|YP_001357043.1| 387092.NIS_1579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]