SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|152991358|ref|YP_001357080.1| from Nitratiruptor sp. SB155-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152991358|ref|YP_001357080.1|
Domain Number 1 Region: 19-151,201-226
Classification Level Classification E-value
Superfamily Cytochrome c 1.55e-20
Family monodomain cytochrome c 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|152991358|ref|YP_001357080.1|
Sequence length 227
Comment cytochrome C oxidase, cbb3-type, subunit II [Nitratiruptor sp. SB155-2]
Sequence
MFGWLERNPFFFAVGVFVVIAFAGLIEIVPDFAQQSRPVAGAKPYSLLELAGRQVYIKDS
CNACHSQLIRPFKSETDRYGMYSLNGEYAYDRPFLWGSKRTGPDLHRVGNYRTSDWHANH
MWDPTSVVPGSIMPAYKHMFKNVTDLETAYAEALTVKKVFNVPYDKDLDGDGKVDVPLGS
FEEAKQRALKYALKVAEETKRQDLVDMVKQGKIPEIVALIAYLNRLQ
Download sequence
Identical sequences A6Q5G4
gi|152991358|ref|YP_001357080.1| WP_012082986.1.54627 387092.NIS_1617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]