SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|152991533|ref|YP_001357255.1| from Nitratiruptor sp. SB155-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152991533|ref|YP_001357255.1|
Domain Number 1 Region: 128-473
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 3.14e-63
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.00032
Further Details:      
 
Domain Number 2 Region: 7-103
Classification Level Classification E-value
Superfamily Cytochrome c 6.92e-16
Family N-terminal (heme c) domain of cytochrome cd1-nitrite reductase 0.026
Further Details:      
 
Domain Number 3 Region: 480-557
Classification Level Classification E-value
Superfamily Cytochrome c 0.0000000000114
Family monodomain cytochrome c 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|152991533|ref|YP_001357255.1|
Sequence length 559
Comment cytochrome C, class I [Nitratiruptor sp. SB155-2]
Sequence
MKQIVLLLFLLTFLPASQLIHELEAKNFQKNGYDSYQKYCAVCHGKNREGVSAPPLLPQF
IKRISDKRLHNIIKNSLPQTLMPKFSFLSNREIEAIIRYLRTPAKNITWSKENIVQSKTV
FSSSKKNLGIKNIENVTLVVERGANRVWVMEDEKVLDKFTFKNVHGGLKYTLDGKNFYVP
TRDGWIGHYSLENGRLEEKIRACVNLRNISLSRDAKYLFATCLLPERVVVFERKDLTPVK
MYDVKGKISALYELYSKDEAIFTLRNSPKLYKVNTKTLQFTSYTLDKPIEDFFIDPFEEY
IIGTTRHGKDLRVYDIHSLKEVFMAHIEGMPHLFSATYWYKDGKFYFATPHLRKPYITIW
QMYEWKLVKKIDVGGDGFFVKTHPQSDYLWVDNGSDQLVLVDKEKYTIKKLVPREGKRYI
HTEFSGDGKYAYLSIYEPDGNLLVWQTDTFKELKDYKANIPVGKYNFINKNRKFYPRLFG
LSIFKEKCWGCHHQTAMAFGPPFAQIAKQRSDEEIMAQITDPANTYKFLGYTRNAMPAFH
LSPKELRCIVDYIKSFKDK
Download sequence
Identical sequences A6Q5Y9
387092.NIS_1793 gi|152991533|ref|YP_001357255.1| WP_012083161.1.54627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]