SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|152991534|ref|YP_001357256.1| from Nitratiruptor sp. SB155-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152991534|ref|YP_001357256.1|
Domain Number 1 Region: 115-552
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 3.4e-106
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.00000000204
Further Details:      
 
Domain Number 2 Region: 9-124
Classification Level Classification E-value
Superfamily Cytochrome c 4.58e-19
Family N-terminal (heme c) domain of cytochrome cd1-nitrite reductase 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|152991534|ref|YP_001357256.1|
Sequence length 552
Comment cytochrome Cd1 nitrite reductase [Nitratiruptor sp. SB155-2]
Sequence
MKLKIGISAFLAVGLVGALQASSDIKLSPEEMKKATQIYFDRCAGCHGMLRKGALGPNLL
PKKTRQIGTKTLEYIIYNGTPGGMPNWGSSGEMTKEETALMAKFIQLPPVSPPEKSMADM
KKTWKVLVPPEKRPKKPETKRNWENYFGVVLRDVGKVAIIDGDTKELVSIVKSGFATHIL
RTSKSGRYMYAIGRDGKASVIDLWMKKPQNVAEIRVCNDARSIDTSKAKGYEDEYAVVGC
YWPPSIVTLKGDTLEPIQIVSTASYTYDTGEFTREARVASIVANHHKPEWVINVKETGQV
WLYNYSDPRDPKIHMLMAERYLHDGGWDLTKRYFLVAANARNKVVAVDTKDGEIAAIIPT
GGTKPHPGRGANVSHPKYGPIWCTGHIGSNDVVCIGTDPTYHPQYAWRVVADIKLPGNGG
GNLFVKTHPACKYIIADRPVNPDRKLQTQLYVIDKNKLKVVKTIKVPKKFVKEHTVTVNG
KKIKVKPRGPVHIEFNKDGDEFWVSVWGNKLVPSAILVYDAEKLKLKKAITGDWVRTPTG
KFNVFNTKYDIY
Download sequence
Identical sequences A6Q5Z0
387092.NIS_1794 gi|152991534|ref|YP_001357256.1| WP_012083162.1.54627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]