SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|116669995|ref|YP_830928.1| from Arthrobacter sp. FB24

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116669995|ref|YP_830928.1|
Domain Number 1 Region: 7-152
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.49e-44
Family Ribonuclease PH domain 1-like 0.000000504
Further Details:      
 
Domain Number 2 Region: 325-497
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.63e-43
Family Ribonuclease PH domain 1-like 0.00000046
Further Details:      
 
Domain Number 3 Region: 153-265
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.09e-24
Family Ribonuclease PH domain 2-like 0.00000639
Further Details:      
 
Domain Number 4 Region: 480-578
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.34e-22
Family Ribonuclease PH domain 2-like 0.0000137
Further Details:      
 
Domain Number 5 Region: 270-350
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 3.4e-19
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00025
Further Details:      
 
Domain Number 6 Region: 580-693
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.05e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116669995|ref|YP_830928.1|
Sequence length 746
Comment polynucleotide phosphorylase/polyadenylase [Arthrobacter sp. FB24]
Sequence
MEGPEIQFSEAVIDNGRFGKRVIRFETGRLAKQAAGAAMVYIDEDTALLSATTAGKHPRE
GFDFFPLTVDVEERMYAAGRIPGSFFRREGRPSTEAILACRLMDRPLRPAFIKGLRNEVQ
IVVTVLAINPDELYDVVAINASSMSTQLSGLPFSGPIGGVRVALVADEHGSQWVAFPKHS
QLENSVFNMVVAGRVAGDDVAIMMVEAEATDNSWNLIKEQGATAPTEEVVSEGLEAAKPF
IKALCDAQADLAARAAKPTVEFPVFLDYEDDAYAAVEAAAAEKLAAVFQIADKQERDAAS
DQLKDDVTSSLAGQFEGREKELSAAFRSVTKHVVRQRILKDQIRIDGRGLTDIRQLTAEV
EVLPRVHGSAIFERGETQIMGVTTLNMLKMEQQIDSLSPVTRKRYMHNYNFPPYSTGETG
RVGSPKRREIGHGALAERALVPVLPSREEFPYAIRQVSEALSSNGSTSMGSVCASTLSML
NAGVPLKAAVAGIAMGLVSDQVDGQTRYAALTDILGAEDAFGDMDFKVAGTSEFVTAIQL
DTKLDGIPASVLAAALKQAREARLHILEVINSAIDTPDELSEFAPRVIAVKIPVDKIGEV
IGPKGKMINQIQEDTGADISIEDDGTVYIGATNGPSADAARSAINAIANPQVPEIGERYL
GTVVKTTTFGAFISLTPGKDGLLHISELRKIAGGKRVDNVEDVVSVGQKIQVEITKIDDR
GKLSLSPVIAEEEGAENAEVAEAAAE
Download sequence
Identical sequences A0JUV8
290399.Arth_1434 gi|116669995|ref|YP_830928.1| WP_011691295.1.37281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]