SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|117623505|ref|YP_852418.1| from Escherichia coli APEC O1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|117623505|ref|YP_852418.1|
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily Phage tail protein-like 3.4e-51
Family Lambda phage gpU-like 0.000000768
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|117623505|ref|YP_852418.1|
Sequence length 131
Comment tail component of prophage [Escherichia coli APEC O1]
Sequence
MKHTDIRAAVLDALEQHEHGATLFDGRPVVFDEEDFPAIAVYLTDAEYTGEELDADTWRA
TLHIEVFLPAQVPDSELDQWMESRIYPAMTAIPALAGLITTMVTQGYEYRRDDDMALWSS
ADLTYSITYEM
Download sequence
Identical sequences A0A027TEK5 A0A029H8L3 A0A029JTU3 A0A064SKV6 A0A066T0V8 A0A070FIR4 A0A073FMF1 A0A074HB32 A0A080GHB9 A0A0E0V4X1 A0A0E0Y1K4 A0A0E2L648 A0A0H2V7H6 A0A0H2YYK0 A0A0H3MH92 A0A0K9TCJ3 A0A0M7PX20 A0A168AG09 A0A1E2VUH9 A0A1E3MV52 A0A1X3KAJ2 A0A222QKH0 A0A235NF94 A0A237EWF9 A0A2H1BHA6 B1ERZ0 B2TW01 B7ML56 B7MW18 B7N3L8 C8U3B0 C8UCF7 D7X114 D7Z7J9 D8A9J0 E1IK18 E3XMF2 E9XM07 H4IB06 H4IRH2 H4J1Z4 H4KGN1 H4LD69 H4UTE1 I2S3I1 I2US07 I2W439 I6C4H6 I6FDI7 L3QNA8 Q1RCD0 S0X8V3 S1PEW8 T5V348 T6AV12 T6HBW1 T6MGP1 T9T0C2 U9Y1W0 U9ZFB2 V0YBV6 V2TQ92 V8FIR7 V8K4V8
gi|187731365|ref|YP_001879927.1| gi|187731596|ref|YP_001880070.1| gi|187734191|ref|YP_001879577.1| gi|386633734|ref|YP_006153453.1| gi|407481650|ref|YP_006778799.1| gi|407482364|ref|YP_006779513.1| gi|386604701|ref|YP_006111001.1| gi|544575778|ref|YP_008571302.1| gi|386628814|ref|YP_006148534.1| gi|260868578|ref|YP_003234980.1| gi|386623844|ref|YP_006143572.1| 199310.c1455 344609.SbBS512_E0888 344609.SbBS512_E1295 344609.SbBS512_E1463 364106.UTI89_C1506 405955.APECO1_405 585035.ECS88_1375 585056.ECUMN_1352 585057.ECIAI39_1864 585395.ECO103_2076 585396.ECO111_2567 585397.ECED1_2092 gi|91210529|ref|YP_540515.1| gi|218558225|ref|YP_002391138.1| gi|407468803|ref|YP_006784755.1| gi|407468970|ref|YP_006784588.1| gi|383178781|ref|YP_005456786.1| gi|260844229|ref|YP_003222007.1| gi|218704582|ref|YP_002412101.1| WP_000683079.1.100052 WP_000683079.1.100116 WP_000683079.1.100138 WP_000683079.1.100151 WP_000683079.1.100194 WP_000683079.1.100252 WP_000683079.1.100283 WP_000683079.1.100451 WP_000683079.1.100499 WP_000683079.1.100531 WP_000683079.1.100685 WP_000683079.1.100735 WP_000683079.1.100738 WP_000683079.1.100752 WP_000683079.1.100851 WP_000683079.1.100867 WP_000683079.1.100898 WP_000683079.1.100950 WP_000683079.1.100959 WP_000683079.1.101186 WP_000683079.1.101214 WP_000683079.1.101255 WP_000683079.1.101293 WP_000683079.1.10131 WP_000683079.1.101313 WP_000683079.1.101359 WP_000683079.1.101399 WP_000683079.1.101429 WP_000683079.1.101583 WP_000683079.1.101630 WP_000683079.1.101693 WP_000683079.1.101700 WP_000683079.1.101769 WP_000683079.1.101786 WP_000683079.1.10181 WP_000683079.1.101845 WP_000683079.1.101889 WP_000683079.1.101926 WP_000683079.1.101984 WP_000683079.1.102021 WP_000683079.1.102122 WP_000683079.1.102144 WP_000683079.1.10222 WP_000683079.1.10233 WP_000683079.1.10326 WP_000683079.1.1040 WP_000683079.1.10491 WP_000683079.1.10492 WP_000683079.1.10651 WP_000683079.1.10697 WP_000683079.1.10705 WP_000683079.1.10715 WP_000683079.1.1073 WP_000683079.1.10744 WP_000683079.1.10786 WP_000683079.1.10787 WP_000683079.1.10798 WP_000683079.1.10869 WP_000683079.1.11057 WP_000683079.1.112 WP_000683079.1.11217 WP_000683079.1.11250 WP_000683079.1.11285 WP_000683079.1.11399 WP_000683079.1.11411 WP_000683079.1.11440 WP_000683079.1.11519 WP_000683079.1.11531 WP_000683079.1.11616 WP_000683079.1.11673 WP_000683079.1.11748 WP_000683079.1.1176 WP_000683079.1.11762 WP_000683079.1.11956 WP_000683079.1.11981 WP_000683079.1.12009 WP_000683079.1.12010 WP_000683079.1.12050 WP_000683079.1.12076 WP_000683079.1.12112 WP_000683079.1.1218 WP_000683079.1.12268 WP_000683079.1.12279 WP_000683079.1.12344 WP_000683079.1.12426 WP_000683079.1.12558 WP_000683079.1.12566 WP_000683079.1.12574 WP_000683079.1.12697 WP_000683079.1.12743 WP_000683079.1.12761 WP_000683079.1.12775 WP_000683079.1.12826 WP_000683079.1.12830 WP_000683079.1.12893 WP_000683079.1.12914 WP_000683079.1.1295 WP_000683079.1.1308 WP_000683079.1.13117 WP_000683079.1.1312 WP_000683079.1.1314 WP_000683079.1.13181 WP_000683079.1.1323 WP_000683079.1.13271 WP_000683079.1.13272 WP_000683079.1.13295 WP_000683079.1.13301 WP_000683079.1.13333 WP_000683079.1.13409 WP_000683079.1.13469 WP_000683079.1.13473 WP_000683079.1.13601 WP_000683079.1.13662 WP_000683079.1.13778 WP_000683079.1.13891 WP_000683079.1.13974 WP_000683079.1.14042 WP_000683079.1.14129 WP_000683079.1.14199 WP_000683079.1.14245 WP_000683079.1.14253 WP_000683079.1.14331 WP_000683079.1.14445 WP_000683079.1.14493 WP_000683079.1.14509 WP_000683079.1.14536 WP_000683079.1.14605 WP_000683079.1.14616 WP_000683079.1.14672 WP_000683079.1.14711 WP_000683079.1.1486 WP_000683079.1.14914 WP_000683079.1.14958 WP_000683079.1.14993 WP_000683079.1.1508 WP_000683079.1.15090 WP_000683079.1.15245 WP_000683079.1.15252 WP_000683079.1.15259 WP_000683079.1.15287 WP_000683079.1.15304 WP_000683079.1.15332 WP_000683079.1.15335 WP_000683079.1.15420 WP_000683079.1.1550 WP_000683079.1.15593 WP_000683079.1.15600 WP_000683079.1.15762 WP_000683079.1.15768 WP_000683079.1.1582 WP_000683079.1.15855 WP_000683079.1.15857 WP_000683079.1.15869 WP_000683079.1.15894 WP_000683079.1.15949 WP_000683079.1.15951 WP_000683079.1.15983 WP_000683079.1.15984 WP_000683079.1.16034 WP_000683079.1.16042 WP_000683079.1.16102 WP_000683079.1.16194 WP_000683079.1.16482 WP_000683079.1.16667 WP_000683079.1.16669 WP_000683079.1.16685 WP_000683079.1.16705 WP_000683079.1.16766 WP_000683079.1.16818 WP_000683079.1.16979 WP_000683079.1.17084 WP_000683079.1.17101 WP_000683079.1.17109 WP_000683079.1.17172 WP_000683079.1.17267 WP_000683079.1.17290 WP_000683079.1.17325 WP_000683079.1.17386 WP_000683079.1.17389 WP_000683079.1.17410 WP_000683079.1.17417 WP_000683079.1.17584 WP_000683079.1.17623 WP_000683079.1.1772 WP_000683079.1.17734 WP_000683079.1.17757 WP_000683079.1.1778 WP_000683079.1.1802 WP_000683079.1.18112 WP_000683079.1.18226 WP_000683079.1.18436 WP_000683079.1.18461 WP_000683079.1.18472 WP_000683079.1.18519 WP_000683079.1.1861 WP_000683079.1.18617 WP_000683079.1.18655 WP_000683079.1.18675 WP_000683079.1.18794 WP_000683079.1.188 WP_000683079.1.18801 WP_000683079.1.18843 WP_000683079.1.18908 WP_000683079.1.1903 WP_000683079.1.19129 WP_000683079.1.19146 WP_000683079.1.19147 WP_000683079.1.19150 WP_000683079.1.19153 WP_000683079.1.19171 WP_000683079.1.19276 WP_000683079.1.19312 WP_000683079.1.19313 WP_000683079.1.19315 WP_000683079.1.19332 WP_000683079.1.19379 WP_000683079.1.19397 WP_000683079.1.19419 WP_000683079.1.19492 WP_000683079.1.1952 WP_000683079.1.19581 WP_000683079.1.1960 WP_000683079.1.19602 WP_000683079.1.1963 WP_000683079.1.1982 WP_000683079.1.19861 WP_000683079.1.1987 WP_000683079.1.19878 WP_000683079.1.19972 WP_000683079.1.2015 WP_000683079.1.20159 WP_000683079.1.20178 WP_000683079.1.20264 WP_000683079.1.2027 WP_000683079.1.20519 WP_000683079.1.20575 WP_000683079.1.20609 WP_000683079.1.20630 WP_000683079.1.20638 WP_000683079.1.20709 WP_000683079.1.20737 WP_000683079.1.20761 WP_000683079.1.20813 WP_000683079.1.20841 WP_000683079.1.2089 WP_000683079.1.20982 WP_000683079.1.21024 WP_000683079.1.21029 WP_000683079.1.21137 WP_000683079.1.21236 WP_000683079.1.21255 WP_000683079.1.21277 WP_000683079.1.21519 WP_000683079.1.21526 WP_000683079.1.21578 WP_000683079.1.21634 WP_000683079.1.21637 WP_000683079.1.21656 WP_000683079.1.21696 WP_000683079.1.21714 WP_000683079.1.21812 WP_000683079.1.21895 WP_000683079.1.2198 WP_000683079.1.22021 WP_000683079.1.22161 WP_000683079.1.22189 WP_000683079.1.22203 WP_000683079.1.22293 WP_000683079.1.22295 WP_000683079.1.2245 WP_000683079.1.22470 WP_000683079.1.22549 WP_000683079.1.22571 WP_000683079.1.22602 WP_000683079.1.22662 WP_000683079.1.22814 WP_000683079.1.22885 WP_000683079.1.23042 WP_000683079.1.23045 WP_000683079.1.23078 WP_000683079.1.23230 WP_000683079.1.23282 WP_000683079.1.23393 WP_000683079.1.23486 WP_000683079.1.23625 WP_000683079.1.23686 WP_000683079.1.23886 WP_000683079.1.23914 WP_000683079.1.23962 WP_000683079.1.24024 WP_000683079.1.2413 WP_000683079.1.24169 WP_000683079.1.2418 WP_000683079.1.24194 WP_000683079.1.24233 WP_000683079.1.2430 WP_000683079.1.24381 WP_000683079.1.24575 WP_000683079.1.24577 WP_000683079.1.24763 WP_000683079.1.24797 WP_000683079.1.24799 WP_000683079.1.24876 WP_000683079.1.24926 WP_000683079.1.25021 WP_000683079.1.25079 WP_000683079.1.25174 WP_000683079.1.25193 WP_000683079.1.25270 WP_000683079.1.2537 WP_000683079.1.25378 WP_000683079.1.25380 WP_000683079.1.25414 WP_000683079.1.25420 WP_000683079.1.25480 WP_000683079.1.255 WP_000683079.1.25652 WP_000683079.1.25712 WP_000683079.1.25750 WP_000683079.1.25755 WP_000683079.1.25890 WP_000683079.1.2606 WP_000683079.1.26092 WP_000683079.1.2612 WP_000683079.1.26125 WP_000683079.1.26259 WP_000683079.1.26262 WP_000683079.1.26270 WP_000683079.1.26284 WP_000683079.1.26325 WP_000683079.1.2642 WP_000683079.1.26467 WP_000683079.1.26480 WP_000683079.1.26575 WP_000683079.1.26579 WP_000683079.1.26590 WP_000683079.1.26613 WP_000683079.1.26627 WP_000683079.1.2665 WP_000683079.1.26659 WP_000683079.1.26688 WP_000683079.1.26716 WP_000683079.1.26782 WP_000683079.1.26837 WP_000683079.1.26839 WP_000683079.1.26943 WP_000683079.1.2700 WP_000683079.1.27019 WP_000683079.1.27043 WP_000683079.1.27057 WP_000683079.1.27060 WP_000683079.1.27234 WP_000683079.1.27260 WP_000683079.1.27292 WP_000683079.1.27396 WP_000683079.1.27424 WP_000683079.1.2755 WP_000683079.1.27560 WP_000683079.1.27585 WP_000683079.1.27618 WP_000683079.1.27691 WP_000683079.1.27723 WP_000683079.1.27797 WP_000683079.1.2782 WP_000683079.1.27856 WP_000683079.1.27871 WP_000683079.1.27913 WP_000683079.1.27932 WP_000683079.1.2794 WP_000683079.1.28026 WP_000683079.1.28051 WP_000683079.1.2811 WP_000683079.1.28184 WP_000683079.1.2823 WP_000683079.1.28305 WP_000683079.1.28345 WP_000683079.1.2838 WP_000683079.1.28440 WP_000683079.1.285 WP_000683079.1.28536 WP_000683079.1.28568 WP_000683079.1.28639 WP_000683079.1.28683 WP_000683079.1.28760 WP_000683079.1.28762 WP_000683079.1.28829 WP_000683079.1.28842 WP_000683079.1.28919 WP_000683079.1.28924 WP_000683079.1.29055 WP_000683079.1.29082 WP_000683079.1.29230 WP_000683079.1.29258 WP_000683079.1.29341 WP_000683079.1.29486 WP_000683079.1.29495 WP_000683079.1.29497 WP_000683079.1.29513 WP_000683079.1.29669 WP_000683079.1.29819 WP_000683079.1.29820 WP_000683079.1.29821 WP_000683079.1.29840 WP_000683079.1.29884 WP_000683079.1.2995 WP_000683079.1.30004 WP_000683079.1.30105 WP_000683079.1.30232 WP_000683079.1.30269 WP_000683079.1.30397 WP_000683079.1.30400 WP_000683079.1.30524 WP_000683079.1.30536 WP_000683079.1.30554 WP_000683079.1.30570 WP_000683079.1.30580 WP_000683079.1.306 WP_000683079.1.3063 WP_000683079.1.30749 WP_000683079.1.30867 WP_000683079.1.30896 WP_000683079.1.30905 WP_000683079.1.30906 WP_000683079.1.30987 WP_000683079.1.31083 WP_000683079.1.31319 WP_000683079.1.31347 WP_000683079.1.31419 WP_000683079.1.31521 WP_000683079.1.31542 WP_000683079.1.31559 WP_000683079.1.31596 WP_000683079.1.31639 WP_000683079.1.31679 WP_000683079.1.31740 WP_000683079.1.31809 WP_000683079.1.31823 WP_000683079.1.31825 WP_000683079.1.31863 WP_000683079.1.31866 WP_000683079.1.3203 WP_000683079.1.32173 WP_000683079.1.32184 WP_000683079.1.32279 WP_000683079.1.32287 WP_000683079.1.32406 WP_000683079.1.32480 WP_000683079.1.32587 WP_000683079.1.32635 WP_000683079.1.32676 WP_000683079.1.32718 WP_000683079.1.32720 WP_000683079.1.32748 WP_000683079.1.3295 WP_000683079.1.33026 WP_000683079.1.33053 WP_000683079.1.33101 WP_000683079.1.33190 WP_000683079.1.33217 WP_000683079.1.33237 WP_000683079.1.33341 WP_000683079.1.33369 WP_000683079.1.33428 WP_000683079.1.33512 WP_000683079.1.3354 WP_000683079.1.33563 WP_000683079.1.33680 WP_000683079.1.33979 WP_000683079.1.34032 WP_000683079.1.3411 WP_000683079.1.34144 WP_000683079.1.34208 WP_000683079.1.34294 WP_000683079.1.34303 WP_000683079.1.3432 WP_000683079.1.34348 WP_000683079.1.34362 WP_000683079.1.34440 WP_000683079.1.34441 WP_000683079.1.34528 WP_000683079.1.34532 WP_000683079.1.34558 WP_000683079.1.34675 WP_000683079.1.34682 WP_000683079.1.34827 WP_000683079.1.34835 WP_000683079.1.34838 WP_000683079.1.34913 WP_000683079.1.35003 WP_000683079.1.35006 WP_000683079.1.35012 WP_000683079.1.35107 WP_000683079.1.35127 WP_000683079.1.35132 WP_000683079.1.35168 WP_000683079.1.35186 WP_000683079.1.35204 WP_000683079.1.35253 WP_000683079.1.35360 WP_000683079.1.35394 WP_000683079.1.35398 WP_000683079.1.35448 WP_000683079.1.35465 WP_000683079.1.35578 WP_000683079.1.35741 WP_000683079.1.35744 WP_000683079.1.35927 WP_000683079.1.35934 WP_000683079.1.3598 WP_000683079.1.35987 WP_000683079.1.36040 WP_000683079.1.36042 WP_000683079.1.36070 WP_000683079.1.36105 WP_000683079.1.36132 WP_000683079.1.3624 WP_000683079.1.36334 WP_000683079.1.36393 WP_000683079.1.36459 WP_000683079.1.365 WP_000683079.1.36500 WP_000683079.1.36545 WP_000683079.1.36747 WP_000683079.1.36799 WP_000683079.1.36812 WP_000683079.1.36975 WP_000683079.1.37006 WP_000683079.1.37032 WP_000683079.1.37146 WP_000683079.1.37313 WP_000683079.1.37342 WP_000683079.1.37360 WP_000683079.1.37419 WP_000683079.1.37477 WP_000683079.1.37485 WP_000683079.1.37510 WP_000683079.1.37736 WP_000683079.1.37766 WP_000683079.1.37847 WP_000683079.1.37923 WP_000683079.1.37940 WP_000683079.1.37967 WP_000683079.1.37984 WP_000683079.1.37995 WP_000683079.1.38033 WP_000683079.1.38120 WP_000683079.1.38194 WP_000683079.1.3822 WP_000683079.1.38234 WP_000683079.1.38257 WP_000683079.1.38293 WP_000683079.1.38567 WP_000683079.1.38626 WP_000683079.1.3873 WP_000683079.1.38777 WP_000683079.1.38827 WP_000683079.1.38835 WP_000683079.1.38937 WP_000683079.1.38950 WP_000683079.1.3912 WP_000683079.1.39123 WP_000683079.1.39155 WP_000683079.1.39196 WP_000683079.1.3921 WP_000683079.1.39254 WP_000683079.1.39305 WP_000683079.1.39313 WP_000683079.1.39327 WP_000683079.1.39335 WP_000683079.1.39402 WP_000683079.1.39492 WP_000683079.1.39651 WP_000683079.1.39690 WP_000683079.1.3970 WP_000683079.1.39709 WP_000683079.1.39715 WP_000683079.1.39973 WP_000683079.1.40 WP_000683079.1.4005 WP_000683079.1.40140 WP_000683079.1.40190 WP_000683079.1.40211 WP_000683079.1.40349 WP_000683079.1.40360 WP_000683079.1.4049 WP_000683079.1.40607 WP_000683079.1.40712 WP_000683079.1.40781 WP_000683079.1.40843 WP_000683079.1.40893 WP_000683079.1.41063 WP_000683079.1.41125 WP_000683079.1.41271 WP_000683079.1.41332 WP_000683079.1.41371 WP_000683079.1.4142 WP_000683079.1.41453 WP_000683079.1.41483 WP_000683079.1.41484 WP_000683079.1.41530 WP_000683079.1.41613 WP_000683079.1.41752 WP_000683079.1.41782 WP_000683079.1.41784 WP_000683079.1.41837 WP_000683079.1.41847 WP_000683079.1.41884 WP_000683079.1.4189 WP_000683079.1.41923 WP_000683079.1.4193 WP_000683079.1.41990 WP_000683079.1.4214 WP_000683079.1.42209 WP_000683079.1.42226 WP_000683079.1.4224 WP_000683079.1.42350 WP_000683079.1.42413 WP_000683079.1.4242 WP_000683079.1.42443 WP_000683079.1.42480 WP_000683079.1.42632 WP_000683079.1.42670 WP_000683079.1.42728 WP_000683079.1.42748 WP_000683079.1.42804 WP_000683079.1.42808 WP_000683079.1.42879 WP_000683079.1.43123 WP_000683079.1.43132 WP_000683079.1.43137 WP_000683079.1.43174 WP_000683079.1.43177 WP_000683079.1.43270 WP_000683079.1.43389 WP_000683079.1.43422 WP_000683079.1.436 WP_000683079.1.43604 WP_000683079.1.43733 WP_000683079.1.43769 WP_000683079.1.43803 WP_000683079.1.43918 WP_000683079.1.440 WP_000683079.1.44051 WP_000683079.1.4411 WP_000683079.1.4415 WP_000683079.1.44251 WP_000683079.1.44264 WP_000683079.1.44287 WP_000683079.1.44394 WP_000683079.1.44445 WP_000683079.1.44452 WP_000683079.1.44460 WP_000683079.1.4454 WP_000683079.1.4463 WP_000683079.1.44642 WP_000683079.1.4471 WP_000683079.1.44724 WP_000683079.1.44756 WP_000683079.1.44759 WP_000683079.1.44855 WP_000683079.1.44960 WP_000683079.1.44977 WP_000683079.1.45190 WP_000683079.1.45208 WP_000683079.1.4524 WP_000683079.1.4541 WP_000683079.1.45525 WP_000683079.1.45674 WP_000683079.1.4570 WP_000683079.1.45718 WP_000683079.1.4576 WP_000683079.1.4583 WP_000683079.1.45865 WP_000683079.1.45891 WP_000683079.1.4593 WP_000683079.1.45990 WP_000683079.1.4600 WP_000683079.1.46026 WP_000683079.1.46070 WP_000683079.1.46097 WP_000683079.1.46217 WP_000683079.1.46263 WP_000683079.1.46477 WP_000683079.1.46531 WP_000683079.1.46555 WP_000683079.1.46614 WP_000683079.1.46616 WP_000683079.1.46643 WP_000683079.1.46743 WP_000683079.1.46795 WP_000683079.1.46798 WP_000683079.1.46820 WP_000683079.1.46833 WP_000683079.1.4695 WP_000683079.1.47024 WP_000683079.1.47030 WP_000683079.1.47034 WP_000683079.1.47039 WP_000683079.1.47047 WP_000683079.1.47050 WP_000683079.1.47069 WP_000683079.1.47073 WP_000683079.1.47156 WP_000683079.1.47189 WP_000683079.1.4722 WP_000683079.1.47246 WP_000683079.1.47316 WP_000683079.1.47398 WP_000683079.1.47414 WP_000683079.1.47546 WP_000683079.1.47582 WP_000683079.1.4772 WP_000683079.1.47770 WP_000683079.1.47848 WP_000683079.1.47983 WP_000683079.1.48000 WP_000683079.1.48029 WP_000683079.1.48077 WP_000683079.1.4811 WP_000683079.1.48111 WP_000683079.1.48121 WP_000683079.1.48229 WP_000683079.1.48285 WP_000683079.1.48353 WP_000683079.1.48480 WP_000683079.1.4857 WP_000683079.1.48620 WP_000683079.1.48629 WP_000683079.1.48689 WP_000683079.1.4871 WP_000683079.1.48801 WP_000683079.1.48907 WP_000683079.1.49001 WP_000683079.1.49061 WP_000683079.1.49104 WP_000683079.1.49107 WP_000683079.1.49124 WP_000683079.1.49136 WP_000683079.1.49147 WP_000683079.1.49229 WP_000683079.1.49363 WP_000683079.1.49412 WP_000683079.1.49446 WP_000683079.1.49483 WP_000683079.1.49521 WP_000683079.1.49522 WP_000683079.1.49546 WP_000683079.1.49599 WP_000683079.1.49662 WP_000683079.1.49675 WP_000683079.1.49684 WP_000683079.1.49747 WP_000683079.1.49774 WP_000683079.1.49788 WP_000683079.1.4985 WP_000683079.1.49856 WP_000683079.1.49902 WP_000683079.1.49954 WP_000683079.1.49972 WP_000683079.1.49987 WP_000683079.1.50098 WP_000683079.1.50196 WP_000683079.1.50214 WP_000683079.1.50228 WP_000683079.1.50230 WP_000683079.1.50258 WP_000683079.1.50381 WP_000683079.1.5040 WP_000683079.1.50418 WP_000683079.1.50452 WP_000683079.1.5046 WP_000683079.1.50548 WP_000683079.1.5064 WP_000683079.1.50715 WP_000683079.1.50717 WP_000683079.1.50725 WP_000683079.1.50728 WP_000683079.1.50887 WP_000683079.1.50936 WP_000683079.1.51201 WP_000683079.1.51278 WP_000683079.1.51307 WP_000683079.1.51336 WP_000683079.1.51360 WP_000683079.1.51405 WP_000683079.1.51426 WP_000683079.1.51427 WP_000683079.1.51441 WP_000683079.1.51525 WP_000683079.1.5153 WP_000683079.1.51539 WP_000683079.1.5172 WP_000683079.1.51873 WP_000683079.1.51896 WP_000683079.1.51944 WP_000683079.1.5199 WP_000683079.1.52126 WP_000683079.1.52137 WP_000683079.1.52171 WP_000683079.1.52230 WP_000683079.1.52236 WP_000683079.1.52257 WP_000683079.1.52258 WP_000683079.1.52363 WP_000683079.1.52542 WP_000683079.1.52568 WP_000683079.1.52601 WP_000683079.1.52691 WP_000683079.1.52771 WP_000683079.1.52853 WP_000683079.1.52855 WP_000683079.1.52995 WP_000683079.1.53021 WP_000683079.1.532 WP_000683079.1.53228 WP_000683079.1.53410 WP_000683079.1.53415 WP_000683079.1.5342 WP_000683079.1.53431 WP_000683079.1.53556 WP_000683079.1.53587 WP_000683079.1.53589 WP_000683079.1.53594 WP_000683079.1.53811 WP_000683079.1.53845 WP_000683079.1.53866 WP_000683079.1.53878 WP_000683079.1.53931 WP_000683079.1.54023 WP_000683079.1.54051 WP_000683079.1.54102 WP_000683079.1.54144 WP_000683079.1.54202 WP_000683079.1.5433 WP_000683079.1.54388 WP_000683079.1.54394 WP_000683079.1.54411 WP_000683079.1.54463 WP_000683079.1.54585 WP_000683079.1.54590 WP_000683079.1.54769 WP_000683079.1.54798 WP_000683079.1.54829 WP_000683079.1.5486 WP_000683079.1.54875 WP_000683079.1.54940 WP_000683079.1.54972 WP_000683079.1.54981 WP_000683079.1.55112 WP_000683079.1.55115 WP_000683079.1.55177 WP_000683079.1.55179 WP_000683079.1.55185 WP_000683079.1.55273 WP_000683079.1.55286 WP_000683079.1.55338 WP_000683079.1.55357 WP_000683079.1.55417 WP_000683079.1.5546 WP_000683079.1.55492 WP_000683079.1.55550 WP_000683079.1.55574 WP_000683079.1.55581 WP_000683079.1.55744 WP_000683079.1.55787 WP_000683079.1.55790 WP_000683079.1.55844 WP_000683079.1.56149 WP_000683079.1.56151 WP_000683079.1.56216 WP_000683079.1.56439 WP_000683079.1.56446 WP_000683079.1.56457 WP_000683079.1.56513 WP_000683079.1.56665 WP_000683079.1.56689 WP_000683079.1.56704 WP_000683079.1.56713 WP_000683079.1.56776 WP_000683079.1.56777 WP_000683079.1.56787 WP_000683079.1.56821 WP_000683079.1.56882 WP_000683079.1.56937 WP_000683079.1.56978 WP_000683079.1.57068 WP_000683079.1.57159 WP_000683079.1.57182 WP_000683079.1.57254 WP_000683079.1.57278 WP_000683079.1.5742 WP_000683079.1.57492 WP_000683079.1.57550 WP_000683079.1.57588 WP_000683079.1.57608 WP_000683079.1.57663 WP_000683079.1.57669 WP_000683079.1.57846 WP_000683079.1.57854 WP_000683079.1.57898 WP_000683079.1.57920 WP_000683079.1.57983 WP_000683079.1.57994 WP_000683079.1.58009 WP_000683079.1.58097 WP_000683079.1.58098 WP_000683079.1.58107 WP_000683079.1.58233 WP_000683079.1.58267 WP_000683079.1.58424 WP_000683079.1.58429 WP_000683079.1.58449 WP_000683079.1.58459 WP_000683079.1.58496 WP_000683079.1.58507 WP_000683079.1.58560 WP_000683079.1.58609 WP_000683079.1.58617 WP_000683079.1.58657 WP_000683079.1.58692 WP_000683079.1.58942 WP_000683079.1.58983 WP_000683079.1.58999 WP_000683079.1.59174 WP_000683079.1.5927 WP_000683079.1.59291 WP_000683079.1.59396 WP_000683079.1.59407 WP_000683079.1.59426 WP_000683079.1.59483 WP_000683079.1.59513 WP_000683079.1.59577 WP_000683079.1.59613 WP_000683079.1.59615 WP_000683079.1.59714 WP_000683079.1.59748 WP_000683079.1.59793 WP_000683079.1.59815 WP_000683079.1.59853 WP_000683079.1.59894 WP_000683079.1.59932 WP_000683079.1.59970 WP_000683079.1.59981 WP_000683079.1.59998 WP_000683079.1.60048 WP_000683079.1.60110 WP_000683079.1.6013 WP_000683079.1.60325 WP_000683079.1.60411 WP_000683079.1.60453 WP_000683079.1.60457 WP_000683079.1.60544 WP_000683079.1.60555 WP_000683079.1.60591 WP_000683079.1.60606 WP_000683079.1.60630 WP_000683079.1.6068 WP_000683079.1.60764 WP_000683079.1.60805 WP_000683079.1.60832 WP_000683079.1.6094 WP_000683079.1.60974 WP_000683079.1.61005 WP_000683079.1.61006 WP_000683079.1.61132 WP_000683079.1.61170 WP_000683079.1.61175 WP_000683079.1.61245 WP_000683079.1.613 WP_000683079.1.61360 WP_000683079.1.61364 WP_000683079.1.61442 WP_000683079.1.615 WP_000683079.1.61517 WP_000683079.1.61524 WP_000683079.1.61663 WP_000683079.1.61772 WP_000683079.1.61789 WP_000683079.1.61853 WP_000683079.1.61985 WP_000683079.1.62038 WP_000683079.1.62041 WP_000683079.1.62099 WP_000683079.1.62266 WP_000683079.1.62282 WP_000683079.1.62481 WP_000683079.1.62586 WP_000683079.1.62631 WP_000683079.1.62642 WP_000683079.1.62762 WP_000683079.1.62812 WP_000683079.1.62819 WP_000683079.1.6282 WP_000683079.1.62843 WP_000683079.1.62866 WP_000683079.1.62951 WP_000683079.1.63310 WP_000683079.1.63330 WP_000683079.1.6334 WP_000683079.1.63419 WP_000683079.1.63470 WP_000683079.1.63602 WP_000683079.1.63608 WP_000683079.1.63683 WP_000683079.1.63800 WP_000683079.1.63814 WP_000683079.1.63969 WP_000683079.1.63990 WP_000683079.1.64014 WP_000683079.1.64138 WP_000683079.1.64165 WP_000683079.1.64312 WP_000683079.1.64330 WP_000683079.1.64438 WP_000683079.1.64448 WP_000683079.1.6446 WP_000683079.1.64563 WP_000683079.1.64657 WP_000683079.1.64866 WP_000683079.1.64875 WP_000683079.1.64901 WP_000683079.1.64939 WP_000683079.1.65104 WP_000683079.1.6511 WP_000683079.1.65110 WP_000683079.1.65116 WP_000683079.1.6527 WP_000683079.1.65296 WP_000683079.1.65305 WP_000683079.1.65355 WP_000683079.1.654 WP_000683079.1.65456 WP_000683079.1.65596 WP_000683079.1.65954 WP_000683079.1.65976 WP_000683079.1.66001 WP_000683079.1.66044 WP_000683079.1.66071 WP_000683079.1.6609 WP_000683079.1.66161 WP_000683079.1.66187 WP_000683079.1.66255 WP_000683079.1.66421 WP_000683079.1.66448 WP_000683079.1.6654 WP_000683079.1.66624 WP_000683079.1.6666 WP_000683079.1.66668 WP_000683079.1.66700 WP_000683079.1.66706 WP_000683079.1.66751 WP_000683079.1.66794 WP_000683079.1.66984 WP_000683079.1.67029 WP_000683079.1.67035 WP_000683079.1.67055 WP_000683079.1.67149 WP_000683079.1.67278 WP_000683079.1.67284 WP_000683079.1.67373 WP_000683079.1.67383 WP_000683079.1.67452 WP_000683079.1.67456 WP_000683079.1.67495 WP_000683079.1.67590 WP_000683079.1.67681 WP_000683079.1.67685 WP_000683079.1.67732 WP_000683079.1.67760 WP_000683079.1.67788 WP_000683079.1.67894 WP_000683079.1.68011 WP_000683079.1.68058 WP_000683079.1.68063 WP_000683079.1.68069 WP_000683079.1.6810 WP_000683079.1.68177 WP_000683079.1.682 WP_000683079.1.68200 WP_000683079.1.68215 WP_000683079.1.68231 WP_000683079.1.68241 WP_000683079.1.68490 WP_000683079.1.68534 WP_000683079.1.6859 WP_000683079.1.68609 WP_000683079.1.68673 WP_000683079.1.68695 WP_000683079.1.68731 WP_000683079.1.68735 WP_000683079.1.68793 WP_000683079.1.68801 WP_000683079.1.68877 WP_000683079.1.68911 WP_000683079.1.68924 WP_000683079.1.69127 WP_000683079.1.69144 WP_000683079.1.69158 WP_000683079.1.69247 WP_000683079.1.69303 WP_000683079.1.69390 WP_000683079.1.69502 WP_000683079.1.69569 WP_000683079.1.69596 WP_000683079.1.697 WP_000683079.1.69716 WP_000683079.1.69735 WP_000683079.1.69832 WP_000683079.1.69963 WP_000683079.1.70041 WP_000683079.1.701 WP_000683079.1.7013 WP_000683079.1.7015 WP_000683079.1.70190 WP_000683079.1.70230 WP_000683079.1.70300 WP_000683079.1.70386 WP_000683079.1.70408 WP_000683079.1.70414 WP_000683079.1.70597 WP_000683079.1.70655 WP_000683079.1.70698 WP_000683079.1.70745 WP_000683079.1.70880 WP_000683079.1.70952 WP_000683079.1.7102 WP_000683079.1.71113 WP_000683079.1.71149 WP_000683079.1.71159 WP_000683079.1.71176 WP_000683079.1.71287 WP_000683079.1.71327 WP_000683079.1.71397 WP_000683079.1.71405 WP_000683079.1.71421 WP_000683079.1.71533 WP_000683079.1.71540 WP_000683079.1.71562 WP_000683079.1.71607 WP_000683079.1.71757 WP_000683079.1.71912 WP_000683079.1.71938 WP_000683079.1.71939 WP_000683079.1.71940 WP_000683079.1.71967 WP_000683079.1.71972 WP_000683079.1.72048 WP_000683079.1.72090 WP_000683079.1.72117 WP_000683079.1.72125 WP_000683079.1.72155 WP_000683079.1.72161 WP_000683079.1.72248 WP_000683079.1.72337 WP_000683079.1.72352 WP_000683079.1.72507 WP_000683079.1.72511 WP_000683079.1.72588 WP_000683079.1.72596 WP_000683079.1.72599 WP_000683079.1.72615 WP_000683079.1.72652 WP_000683079.1.72694 WP_000683079.1.72695 WP_000683079.1.72706 WP_000683079.1.72778 WP_000683079.1.72806 WP_000683079.1.72857 WP_000683079.1.72893 WP_000683079.1.72956 WP_000683079.1.73075 WP_000683079.1.7309 WP_000683079.1.73217 WP_000683079.1.73283 WP_000683079.1.73592 WP_000683079.1.73717 WP_000683079.1.73811 WP_000683079.1.73835 WP_000683079.1.74032 WP_000683079.1.74041 WP_000683079.1.74045 WP_000683079.1.74053 WP_000683079.1.7407 WP_000683079.1.7411 WP_000683079.1.74243 WP_000683079.1.74426 WP_000683079.1.74574 WP_000683079.1.74623 WP_000683079.1.74624 WP_000683079.1.74631 WP_000683079.1.74735 WP_000683079.1.74767 WP_000683079.1.7478 WP_000683079.1.7479 WP_000683079.1.74793 WP_000683079.1.74811 WP_000683079.1.74915 WP_000683079.1.74993 WP_000683079.1.75021 WP_000683079.1.75030 WP_000683079.1.75087 WP_000683079.1.75100 WP_000683079.1.75155 WP_000683079.1.75218 WP_000683079.1.75306 WP_000683079.1.7536 WP_000683079.1.75382 WP_000683079.1.75676 WP_000683079.1.75725 WP_000683079.1.75767 WP_000683079.1.75839 WP_000683079.1.76005 WP_000683079.1.7603 WP_000683079.1.76036 WP_000683079.1.76039 WP_000683079.1.76057 WP_000683079.1.76103 WP_000683079.1.76119 WP_000683079.1.76194 WP_000683079.1.76268 WP_000683079.1.76335 WP_000683079.1.76387 WP_000683079.1.76390 WP_000683079.1.76448 WP_000683079.1.76452 WP_000683079.1.76619 WP_000683079.1.76643 WP_000683079.1.76660 WP_000683079.1.7680 WP_000683079.1.76815 WP_000683079.1.76840 WP_000683079.1.7699 WP_000683079.1.76994 WP_000683079.1.77007 WP_000683079.1.77042 WP_000683079.1.77081 WP_000683079.1.77162 WP_000683079.1.77253 WP_000683079.1.77290 WP_000683079.1.77291 WP_000683079.1.77296 WP_000683079.1.77437 WP_000683079.1.77455 WP_000683079.1.77462 WP_000683079.1.7747 WP_000683079.1.77477 WP_000683079.1.775 WP_000683079.1.7750 WP_000683079.1.77511 WP_000683079.1.77542 WP_000683079.1.77551 WP_000683079.1.77577 WP_000683079.1.77657 WP_000683079.1.77741 WP_000683079.1.7780 WP_000683079.1.77816 WP_000683079.1.78010 WP_000683079.1.78097 WP_000683079.1.78102 WP_000683079.1.78131 WP_000683079.1.78187 WP_000683079.1.78232 WP_000683079.1.78323 WP_000683079.1.78413 WP_000683079.1.78445 WP_000683079.1.78453 WP_000683079.1.78462 WP_000683079.1.78512 WP_000683079.1.78575 WP_000683079.1.78775 WP_000683079.1.78891 WP_000683079.1.78893 WP_000683079.1.78919 WP_000683079.1.78955 WP_000683079.1.78956 WP_000683079.1.78996 WP_000683079.1.79067 WP_000683079.1.79092 WP_000683079.1.79126 WP_000683079.1.79159 WP_000683079.1.79233 WP_000683079.1.79248 WP_000683079.1.79343 WP_000683079.1.79464 WP_000683079.1.79519 WP_000683079.1.79526 WP_000683079.1.79558 WP_000683079.1.79759 WP_000683079.1.7985 WP_000683079.1.79869 WP_000683079.1.79871 WP_000683079.1.79922 WP_000683079.1.79936 WP_000683079.1.79944 WP_000683079.1.79952 WP_000683079.1.80043 WP_000683079.1.80141 WP_000683079.1.80292 WP_000683079.1.80310 WP_000683079.1.804 WP_000683079.1.80484 WP_000683079.1.80517 WP_000683079.1.80558 WP_000683079.1.80660 WP_000683079.1.80718 WP_000683079.1.80736 WP_000683079.1.80753 WP_000683079.1.80754 WP_000683079.1.808 WP_000683079.1.80843 WP_000683079.1.80945 WP_000683079.1.80948 WP_000683079.1.80983 WP_000683079.1.810 WP_000683079.1.81026 WP_000683079.1.81098 WP_000683079.1.81160 WP_000683079.1.8118 WP_000683079.1.81186 WP_000683079.1.81266 WP_000683079.1.81316 WP_000683079.1.81323 WP_000683079.1.81347 WP_000683079.1.81376 WP_000683079.1.81396 WP_000683079.1.81423 WP_000683079.1.81517 WP_000683079.1.81688 WP_000683079.1.81715 WP_000683079.1.81819 WP_000683079.1.81843 WP_000683079.1.81888 WP_000683079.1.82059 WP_000683079.1.82166 WP_000683079.1.82221 WP_000683079.1.82326 WP_000683079.1.82330 WP_000683079.1.82439 WP_000683079.1.82514 WP_000683079.1.8255 WP_000683079.1.82572 WP_000683079.1.82589 WP_000683079.1.82698 WP_000683079.1.82780 WP_000683079.1.82808 WP_000683079.1.82901 WP_000683079.1.83051 WP_000683079.1.8308 WP_000683079.1.83093 WP_000683079.1.83127 WP_000683079.1.83205 WP_000683079.1.83218 WP_000683079.1.83238 WP_000683079.1.83253 WP_000683079.1.83256 WP_000683079.1.83313 WP_000683079.1.83330 WP_000683079.1.83393 WP_000683079.1.83506 WP_000683079.1.83584 WP_000683079.1.83668 WP_000683079.1.83706 WP_000683079.1.83762 WP_000683079.1.83820 WP_000683079.1.83936 WP_000683079.1.84060 WP_000683079.1.8408 WP_000683079.1.84197 WP_000683079.1.84221 WP_000683079.1.84319 WP_000683079.1.84326 WP_000683079.1.84339 WP_000683079.1.84464 WP_000683079.1.84486 WP_000683079.1.84518 WP_000683079.1.84675 WP_000683079.1.8470 WP_000683079.1.84731 WP_000683079.1.84878 WP_000683079.1.84881 WP_000683079.1.84916 WP_000683079.1.85025 WP_000683079.1.85077 WP_000683079.1.85085 WP_000683079.1.85106 WP_000683079.1.8517 WP_000683079.1.85241 WP_000683079.1.85252 WP_000683079.1.85320 WP_000683079.1.85335 WP_000683079.1.85336 WP_000683079.1.85342 WP_000683079.1.85435 WP_000683079.1.85500 WP_000683079.1.85546 WP_000683079.1.85563 WP_000683079.1.85593 WP_000683079.1.85601 WP_000683079.1.8564 WP_000683079.1.8582 WP_000683079.1.86016 WP_000683079.1.8603 WP_000683079.1.86105 WP_000683079.1.86145 WP_000683079.1.86176 WP_000683079.1.86179 WP_000683079.1.8621 WP_000683079.1.86210 WP_000683079.1.86261 WP_000683079.1.86273 WP_000683079.1.86280 WP_000683079.1.8635 WP_000683079.1.86451 WP_000683079.1.86586 WP_000683079.1.86609 WP_000683079.1.86613 WP_000683079.1.86627 WP_000683079.1.86731 WP_000683079.1.86753 WP_000683079.1.86788 WP_000683079.1.86935 WP_000683079.1.86975 WP_000683079.1.8705 WP_000683079.1.87177 WP_000683079.1.87205 WP_000683079.1.87339 WP_000683079.1.87371 WP_000683079.1.87504 WP_000683079.1.87590 WP_000683079.1.87655 WP_000683079.1.87728 WP_000683079.1.87766 WP_000683079.1.87973 WP_000683079.1.87990 WP_000683079.1.880 WP_000683079.1.88119 WP_000683079.1.88260 WP_000683079.1.88467 WP_000683079.1.88505 WP_000683079.1.88535 WP_000683079.1.8854 WP_000683079.1.88557 WP_000683079.1.88678 WP_000683079.1.88686 WP_000683079.1.88711 WP_000683079.1.88717 WP_000683079.1.88720 WP_000683079.1.8873 WP_000683079.1.88757 WP_000683079.1.8879 WP_000683079.1.88793 WP_000683079.1.88953 WP_000683079.1.89043 WP_000683079.1.89050 WP_000683079.1.89067 WP_000683079.1.89069 WP_000683079.1.89097 WP_000683079.1.89163 WP_000683079.1.89183 WP_000683079.1.8928 WP_000683079.1.89285 WP_000683079.1.89351 WP_000683079.1.8938 WP_000683079.1.89396 WP_000683079.1.89400 WP_000683079.1.89403 WP_000683079.1.89427 WP_000683079.1.89466 WP_000683079.1.89469 WP_000683079.1.89474 WP_000683079.1.89583 WP_000683079.1.89631 WP_000683079.1.89656 WP_000683079.1.89747 WP_000683079.1.89781 WP_000683079.1.89841 WP_000683079.1.8985 WP_000683079.1.90022 WP_000683079.1.90063 WP_000683079.1.90115 WP_000683079.1.90182 WP_000683079.1.90349 WP_000683079.1.90436 WP_000683079.1.90547 WP_000683079.1.90602 WP_000683079.1.90690 WP_000683079.1.90775 WP_000683079.1.90842 WP_000683079.1.90844 WP_000683079.1.90905 WP_000683079.1.90960 WP_000683079.1.90997 WP_000683079.1.91007 WP_000683079.1.91010 WP_000683079.1.91113 WP_000683079.1.91117 WP_000683079.1.91213 WP_000683079.1.91361 WP_000683079.1.91414 WP_000683079.1.91482 WP_000683079.1.91543 WP_000683079.1.91549 WP_000683079.1.91565 WP_000683079.1.91594 WP_000683079.1.91596 WP_000683079.1.9160 WP_000683079.1.91644 WP_000683079.1.91756 WP_000683079.1.91779 WP_000683079.1.91782 WP_000683079.1.91814 WP_000683079.1.91863 WP_000683079.1.91887 WP_000683079.1.91893 WP_000683079.1.91971 WP_000683079.1.92053 WP_000683079.1.92096 WP_000683079.1.92161 WP_000683079.1.92201 WP_000683079.1.92295 WP_000683079.1.92403 WP_000683079.1.92473 WP_000683079.1.92496 WP_000683079.1.92648 WP_000683079.1.92767 WP_000683079.1.92845 WP_000683079.1.92882 WP_000683079.1.92886 WP_000683079.1.93005 WP_000683079.1.93033 WP_000683079.1.93085 WP_000683079.1.93133 WP_000683079.1.93139 WP_000683079.1.93167 WP_000683079.1.93185 WP_000683079.1.93233 WP_000683079.1.93276 WP_000683079.1.9331 WP_000683079.1.93312 WP_000683079.1.93453 WP_000683079.1.93531 WP_000683079.1.93533 WP_000683079.1.93552 WP_000683079.1.9356 WP_000683079.1.93569 WP_000683079.1.93639 WP_000683079.1.93694 WP_000683079.1.93745 WP_000683079.1.93870 WP_000683079.1.93952 WP_000683079.1.9420 WP_000683079.1.94232 WP_000683079.1.94282 WP_000683079.1.94367 WP_000683079.1.94430 WP_000683079.1.94438 WP_000683079.1.94446 WP_000683079.1.94475 WP_000683079.1.94507 WP_000683079.1.94686 WP_000683079.1.94704 WP_000683079.1.94738 WP_000683079.1.948 WP_000683079.1.94801 WP_000683079.1.94806 WP_000683079.1.94808 WP_000683079.1.94823 WP_000683079.1.94841 WP_000683079.1.94869 WP_000683079.1.949 WP_000683079.1.95080 WP_000683079.1.95084 WP_000683079.1.95161 WP_000683079.1.95310 WP_000683079.1.95329 WP_000683079.1.95332 WP_000683079.1.95364 WP_000683079.1.95390 WP_000683079.1.95438 WP_000683079.1.95596 WP_000683079.1.95784 WP_000683079.1.95846 WP_000683079.1.95858 WP_000683079.1.95861 WP_000683079.1.95865 WP_000683079.1.95929 WP_000683079.1.95931 WP_000683079.1.95951 WP_000683079.1.96086 WP_000683079.1.96110 WP_000683079.1.96114 WP_000683079.1.96145 WP_000683079.1.96247 WP_000683079.1.96253 WP_000683079.1.96263 WP_000683079.1.96290 WP_000683079.1.96303 WP_000683079.1.96341 WP_000683079.1.96378 WP_000683079.1.96450 WP_000683079.1.96478 WP_000683079.1.96484 WP_000683079.1.96558 WP_000683079.1.96562 WP_000683079.1.9661 WP_000683079.1.96617 WP_000683079.1.96633 WP_000683079.1.96659 WP_000683079.1.96676 WP_000683079.1.96762 WP_000683079.1.96797 WP_000683079.1.96817 WP_000683079.1.96820 WP_000683079.1.96850 WP_000683079.1.96864 WP_000683079.1.96894 WP_000683079.1.96944 WP_000683079.1.96984 WP_000683079.1.96989 WP_000683079.1.97147 WP_000683079.1.97226 WP_000683079.1.97231 WP_000683079.1.97248 WP_000683079.1.97282 WP_000683079.1.97292 WP_000683079.1.97344 WP_000683079.1.97434 WP_000683079.1.97459 WP_000683079.1.97525 WP_000683079.1.97549 WP_000683079.1.97560 WP_000683079.1.97571 WP_000683079.1.97654 WP_000683079.1.97778 WP_000683079.1.97890 WP_000683079.1.97919 WP_000683079.1.9816 WP_000683079.1.98167 WP_000683079.1.98357 WP_000683079.1.98480 WP_000683079.1.98549 WP_000683079.1.98614 WP_000683079.1.98626 WP_000683079.1.98668 WP_000683079.1.98683 WP_000683079.1.98702 WP_000683079.1.98727 WP_000683079.1.98757 WP_000683079.1.98775 WP_000683079.1.98784 WP_000683079.1.99029 WP_000683079.1.99046 WP_000683079.1.99060 WP_000683079.1.99182 WP_000683079.1.99302 WP_000683079.1.99304 WP_000683079.1.99307 WP_000683079.1.99349 WP_000683079.1.99401 WP_000683079.1.99458 WP_000683079.1.99471 WP_000683079.1.9950 WP_000683079.1.99511 WP_000683079.1.99549 WP_000683079.1.99571 WP_000683079.1.99592 WP_000683079.1.99632 WP_000683079.1.99694 WP_000683079.1.99771 WP_000683079.1.99891 WP_000683079.1.99892 YP_002407843.1.10275 YP_002412101.1.14968 YP_006778799.1.12065 YP_006779513.1.12065 gi|117623505|ref|YP_852418.1| gi|410482916|ref|YP_006770462.1| gi|218689823|ref|YP_002398035.1| gi|387506778|ref|YP_006159034.1| gi|387507230|ref|YP_006159486.1| gi|387507457|ref|YP_006159713.1| gi|26247324|ref|NP_753364.1| gi|386599140|ref|YP_006100646.1| gi|218700214|ref|YP_002407843.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]