SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|117624859|ref|YP_853772.1| from Escherichia coli APEC O1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|117624859|ref|YP_853772.1|
Domain Number - Region: 57-134
Classification Level Classification E-value
Superfamily Phage tail protein-like 0.0575
Family STM4215-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|117624859|ref|YP_853772.1|
Sequence length 186
Comment hypothetical protein APECO1_3897 [Escherichia coli APEC O1]
Sequence
MKLTPVIAALRARCPYFENRVAGAAQFKNLPEVGKLRLPAAYVVPGDDSPGENKSQTDYW
QELKEGFSVVVILSNGRDERGQFASYDVVDDVRQMLFKALLGWNPEACGNPITYDGGTLL
DLNRHELIYQFDFSVIRELTEDDTRQQDDLNSLDELRTLAIDVDYLDPGNGSDGDIEHHT
EIPLPS
Download sequence
Identical sequences A0A0E2L0M4 A0A0H2Z2J6 A0A1V2STZ6 A0A1X3K4T4 B7MJM8 Q1R883
gi|386603324|ref|YP_006109624.1| gi|218559607|ref|YP_002392520.1| gi|117624859|ref|YP_853772.1| 364106.UTI89_C2975 405955.APECO1_3897 585035.ECS88_2878 gi|386600611|ref|YP_006102117.1| gi|91211976|ref|YP_541962.1| WP_000779291.1.100735 WP_000779291.1.100738 WP_000779291.1.100898 WP_000779291.1.101152 WP_000779291.1.101926 WP_000779291.1.102144 WP_000779291.1.10326 WP_000779291.1.10492 WP_000779291.1.11250 WP_000779291.1.11531 WP_000779291.1.12009 WP_000779291.1.12010 WP_000779291.1.12076 WP_000779291.1.12761 WP_000779291.1.1323 WP_000779291.1.14331 WP_000779291.1.14509 WP_000779291.1.15857 WP_000779291.1.17584 WP_000779291.1.1802 WP_000779291.1.19146 WP_000779291.1.1987 WP_000779291.1.2027 WP_000779291.1.20709 WP_000779291.1.20761 WP_000779291.1.21714 WP_000779291.1.22189 WP_000779291.1.2245 WP_000779291.1.23230 WP_000779291.1.23962 WP_000779291.1.24169 WP_000779291.1.25021 WP_000779291.1.25174 WP_000779291.1.25270 WP_000779291.1.25712 WP_000779291.1.2606 WP_000779291.1.26092 WP_000779291.1.26627 WP_000779291.1.26659 WP_000779291.1.26782 WP_000779291.1.27932 WP_000779291.1.2794 WP_000779291.1.28051 WP_000779291.1.285 WP_000779291.1.28842 WP_000779291.1.29820 WP_000779291.1.30269 WP_000779291.1.30570 WP_000779291.1.30905 WP_000779291.1.31559 WP_000779291.1.31823 WP_000779291.1.31863 WP_000779291.1.32718 WP_000779291.1.33217 WP_000779291.1.33563 WP_000779291.1.34303 WP_000779291.1.3432 WP_000779291.1.36132 WP_000779291.1.36414 WP_000779291.1.365 WP_000779291.1.36799 WP_000779291.1.37313 WP_000779291.1.37736 WP_000779291.1.38194 WP_000779291.1.38567 WP_000779291.1.39327 WP_000779291.1.41847 WP_000779291.1.4189 WP_000779291.1.41923 WP_000779291.1.42413 WP_000779291.1.42670 WP_000779291.1.42804 WP_000779291.1.43803 WP_000779291.1.46263 WP_000779291.1.46798 WP_000779291.1.46833 WP_000779291.1.48629 WP_000779291.1.49522 WP_000779291.1.49794 WP_000779291.1.50887 WP_000779291.1.51896 WP_000779291.1.51944 WP_000779291.1.52363 WP_000779291.1.53410 WP_000779291.1.53690 WP_000779291.1.54102 WP_000779291.1.54388 WP_000779291.1.54875 WP_000779291.1.55179 WP_000779291.1.55550 WP_000779291.1.56469 WP_000779291.1.57854 WP_000779291.1.58009 WP_000779291.1.58107 WP_000779291.1.58424 WP_000779291.1.59291 WP_000779291.1.59714 WP_000779291.1.59894 WP_000779291.1.613 WP_000779291.1.62038 WP_000779291.1.62236 WP_000779291.1.62866 WP_000779291.1.62951 WP_000779291.1.64312 WP_000779291.1.64875 WP_000779291.1.65355 WP_000779291.1.66071 WP_000779291.1.66255 WP_000779291.1.66668 WP_000779291.1.67055 WP_000779291.1.67284 WP_000779291.1.67373 WP_000779291.1.67495 WP_000779291.1.68058 WP_000779291.1.6859 WP_000779291.1.68735 WP_000779291.1.68877 WP_000779291.1.68911 WP_000779291.1.69502 WP_000779291.1.70300 WP_000779291.1.70386 WP_000779291.1.70408 WP_000779291.1.70655 WP_000779291.1.71562 WP_000779291.1.71607 WP_000779291.1.71972 WP_000779291.1.72588 WP_000779291.1.72596 WP_000779291.1.72706 WP_000779291.1.7407 WP_000779291.1.74623 WP_000779291.1.74767 WP_000779291.1.76057 WP_000779291.1.76194 WP_000779291.1.76335 WP_000779291.1.77007 WP_000779291.1.77511 WP_000779291.1.78187 WP_000779291.1.804 WP_000779291.1.81186 WP_000779291.1.81347 WP_000779291.1.81396 WP_000779291.1.82166 WP_000779291.1.83218 WP_000779291.1.83313 WP_000779291.1.83393 WP_000779291.1.83506 WP_000779291.1.83668 WP_000779291.1.84197 WP_000779291.1.86586 WP_000779291.1.8705 WP_000779291.1.87504 WP_000779291.1.87590 WP_000779291.1.88234 WP_000779291.1.89351 WP_000779291.1.89427 WP_000779291.1.89747 WP_000779291.1.90602 WP_000779291.1.91814 WP_000779291.1.92053 WP_000779291.1.92403 WP_000779291.1.92648 WP_000779291.1.93694 WP_000779291.1.9420 WP_000779291.1.94282 WP_000779291.1.94446 WP_000779291.1.95310 WP_000779291.1.96253 WP_000779291.1.96478 WP_000779291.1.96633 WP_000779291.1.96797 WP_000779291.1.97525 WP_000779291.1.97778 WP_000779291.1.98775 WP_000779291.1.99401 WP_000779291.1.9950 WP_000779291.1.99549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]