SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397667524|ref|YP_006509061.1| from Legionella pneumophila subsp. pneumophila

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397667524|ref|YP_006509061.1|
Domain Number 1 Region: 12-215
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00000844
Family BCR-homology GTPase activation domain (BH-domain) 0.014
Further Details:      
 
Weak hits

Sequence:  gi|397667524|ref|YP_006509061.1|
Domain Number - Region: 259-330
Classification Level Classification E-value
Superfamily Prefoldin 0.0214
Family Prefoldin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397667524|ref|YP_006509061.1|
Sequence length 398
Comment hypothetical protein LPV_2067 [Legionella pneumophila subsp. pneumophila]
Sequence
MPPPYSTHVIVNVFRCVAQLVSQNPELLNWPGVFRLAGSREESEKLLEQVINDNFSVGNL
ACYILEDGQINNLHLNNVLGMLPLVLKESVLLKTEDPLLKLFMTELKNLLSSEKNNVENT
DAIVQLLSKFIDSLLLSKILDHQRVGEILYHYCYLMHTAGVFYETNLMTWENLAIIMAPH
FTNEFGLYPAEDLLGLIQFTNQLKPILECFIAHPDSGIPFKERHADKLEHLAKTRHTIVE
KLTHMGSESRRIVVAPMKSLMLQASMLRAQIDTVETQSKDSSLKKKDKKELNRQLEKLTE
ELEKLNIEISGLTSKIKKMNHGHAKLKEEIRVISRSEDAVSTHATQQSGASSSSSNSVRI
QLGIFGNNSSSSAYLIEEQEEGEVTENEYSGLDSAKLT
Download sequence
Identical sequences gi|397667524|ref|YP_006509061.1| WP_014844163.1.25422 WP_014844163.1.28782 WP_014844163.1.38809 WP_014844163.1.58065 WP_014844163.1.77360 WP_014844163.1.90718 WP_014844163.1.99481 WP_014844163.1.9970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]